KEGG   Serratia liquefaciens: M495_09630Help
Entry
M495_09630        CDS       T02740                                 

Definition
RbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
slq  Serratia liquefaciens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    M495_09630
Enzymes [BR:slq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     M495_09630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2025450..2026322
Genome map
AA seq 290 aa AA seqDB search
MGKILVTGSLHYDIVIHAHHRPEKGETVIGSGCSYKFGGKGGNQAVAAAKAGAQVGFVGA
VGADTQGEFLRAVLDENGIDNRFVTVNESVASGMSVALMDAEGDYGAVVVSNANNHIDVA
QFNDDLLWQQVEMLLLQNEVSEAVNLSAAKQAKQRGIRVCLNAAPARALCAEMQYAVDLL
VVNGVEARDLSGIPVNNLSDACMAAELLSQHYPAVIVTAGEHGVAWCEAGDRSQSMPAEK
VELVSTHGAGDCFMGTLCTSILQHESLGSSVAKANRAAAAHVSRKSTAIN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaattttagtcacgggtagccttcattacgacatcgtgatccatgcgcatcac
cggccggaaaagggcgaaacagtcatcggaagcgggtgttcgtataaattcggcggtaag
ggcggcaatcaggccgttgctgcggcgaaagcgggcgcgcaggtgggctttgtcggtgcc
gtgggcgcagatacgcagggggaattcctgcgcgctgtgcttgatgaaaacggcatcgat
aatcgctttgtgacggtgaatgagagcgtagcctccggtatgagtgtggcactgatggac
gctgagggagattacggcgcagtggtagtctccaacgcgaataatcacattgatgtcgca
cagtttaatgatgacctgttgtggcaacaggttgagatgttgctgttgcaaaatgaggta
tctgaagcagttaatctgtcggccgcgaaacaggcaaaacagcgtgggatccgcgtttgt
ctgaatgccgcaccggcgcgagcattgtgtgccgagatgcagtatgcggttgatctgctg
gtggtgaatggcgttgaagctcgtgatctgagtggtattccggtcaataatttatccgat
gcatgcatggcggctgaattgctcagccagcattatccggctgtgattgtgacggcaggt
gaacatggcgtggcctggtgtgaggctggagaccgtagccagtcgatgcctgccgaaaaa
gtagaacttgtgagcactcacggtgccggtgactgttttatgggcaccttatgcacttca
attcttcaacacgaatcgcttgggagttctgtagcaaaagccaatcgagctgcggccgcc
catgtttcacgtaagtcgacagctataaactaa

DBGET integrated database retrieval system