KEGG   Serratia liquefaciens: M495_12295Help
Entry
M495_12295        CDS       T02740                                 

Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
slq  Serratia liquefaciens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:slq00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:slq00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:slq00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:slq00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2576372..2577646
Genome map
AA seq 424 aa AA seqDB search
MEKLSYASESSTTAWATYLQQIDRVAPYLGELSRWVDTLRHPKRALIVDIPLQMDDGSIR
HFEGFRVQHNLSRGPGKGGIRYHPDVDLDEVMALSAWMTIKCAAVNLPYGGAKGGIRVDP
FKLSEGELERLTRRYTSEIGFIIGPQKDIPAPDVGTNSKVMAWMMDTYSMNHGTTITGVV
TGKPIHLGGSLGREKATGRGVFVTGCEVAKRLGVQLEGAKVAVQGFGNVGSEAARLFVGI
GARVVVIQDHSATLSNPDGIDLNALTEWQAKNKQIAGFPGAKEIESEAFWSVDMDILIPA
ALEGQITRQRAEILSAKLVLEGANGPTYPDADDVLRSRNITVVPDVICNAGGVTVSYFEW
VQDMASYFWSESEINERMDKIMTDAMVHVWNKSEEKKCSLRTAAYIVACERILTARKERG
IYPG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagctatcctacgcttcagaaagcagcacaacggcctgggccacctatctgcaa
caaatcgaccgcgttgcaccttatctcggtgagctgtcgcgttgggttgataccctgcgt
caccctaagcgtgcgctgatcgttgatattcctctgcagatggacgacggttcaatccgc
cacttcgaaggtttccgcgttcagcacaacctgtcgcgcggcccgggtaaaggcggcatc
cgttaccacccagatgttgatctcgatgaggttatggcgctgtcagcctggatgaccatc
aaatgtgcggcagttaacctgccttacggtggcgccaagggggggatccgcgtcgatcct
ttcaaactgtctgaaggcgagctggaaagattgacccgccgctacaccagcgaaatcggc
tttatcatcgggccacagaaagatattcccgcaccggacgtcggcaccaactccaaagtg
atggcctggatgatggatacctactccatgaaccacggcactaccatcaccggcgttgtc
accggtaagcctatccacctgggcggctctctgggccgtgaaaaagcgactggccgtggc
gtgttcgtgaccggttgtgaagtggccaaacgtttgggcgtacagcttgaaggtgccaaa
gtggcggtacagggctttggtaacgtgggcagcgaagcggctcgtctgttcgtcggcatc
ggcgcacgcgtagtcgtgatccaggaccactcagcgaccctgtccaacccggatggcatc
gacctgaacgcattgaccgaatggcaagccaagaacaagcagatcgctggcttccctggc
gctaaagaaatcgaaagcgaagctttctggtccgtcgacatggacatcctgatcccagcc
gccctggaaggtcagatcacccgtcaacgtgcagaaatcctcagcgccaagctggtactg
gaaggggcaaacggcccaacctacccagatgcggacgacgttctgcgttcacgcaacatc
accgtagtgcctgacgttatctgtaacgccggcggcgtgaccgtcagttacttcgagtgg
gtacaggacatggccagctacttctggagcgaaagcgaaatcaacgagcgtatggacaag
atcatgaccgacgctatggttcacgtttggaacaagtccgaagagaagaaatgcagcctg
cgcaccgcggcctatatcgtcgcctgtgagcgtatcctgaccgcacgtaaagagcgtggc
atttacccaggttaa

DBGET integrated database retrieval system