KEGG   Serratia liquefaciens: M495_12295Help
Entry
M495_12295        CDS       T02740                                 

Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
slq  Serratia liquefaciens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    M495_12295
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M495_12295
   00330 Arginine and proline metabolism
    M495_12295
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    M495_12295
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     M495_12295
Exosome [BR:slq04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   M495_12295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2576372..2577646
Genome map
AA seq 424 aa AA seqDB search
MEKLSYASESSTTAWATYLQQIDRVAPYLGELSRWVDTLRHPKRALIVDIPLQMDDGSIR
HFEGFRVQHNLSRGPGKGGIRYHPDVDLDEVMALSAWMTIKCAAVNLPYGGAKGGIRVDP
FKLSEGELERLTRRYTSEIGFIIGPQKDIPAPDVGTNSKVMAWMMDTYSMNHGTTITGVV
TGKPIHLGGSLGREKATGRGVFVTGCEVAKRLGVQLEGAKVAVQGFGNVGSEAARLFVGI
GARVVVIQDHSATLSNPDGIDLNALTEWQAKNKQIAGFPGAKEIESEAFWSVDMDILIPA
ALEGQITRQRAEILSAKLVLEGANGPTYPDADDVLRSRNITVVPDVICNAGGVTVSYFEW
VQDMASYFWSESEINERMDKIMTDAMVHVWNKSEEKKCSLRTAAYIVACERILTARKERG
IYPG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagctatcctacgcttcagaaagcagcacaacggcctgggccacctatctgcaa
caaatcgaccgcgttgcaccttatctcggtgagctgtcgcgttgggttgataccctgcgt
caccctaagcgtgcgctgatcgttgatattcctctgcagatggacgacggttcaatccgc
cacttcgaaggtttccgcgttcagcacaacctgtcgcgcggcccgggtaaaggcggcatc
cgttaccacccagatgttgatctcgatgaggttatggcgctgtcagcctggatgaccatc
aaatgtgcggcagttaacctgccttacggtggcgccaagggggggatccgcgtcgatcct
ttcaaactgtctgaaggcgagctggaaagattgacccgccgctacaccagcgaaatcggc
tttatcatcgggccacagaaagatattcccgcaccggacgtcggcaccaactccaaagtg
atggcctggatgatggatacctactccatgaaccacggcactaccatcaccggcgttgtc
accggtaagcctatccacctgggcggctctctgggccgtgaaaaagcgactggccgtggc
gtgttcgtgaccggttgtgaagtggccaaacgtttgggcgtacagcttgaaggtgccaaa
gtggcggtacagggctttggtaacgtgggcagcgaagcggctcgtctgttcgtcggcatc
ggcgcacgcgtagtcgtgatccaggaccactcagcgaccctgtccaacccggatggcatc
gacctgaacgcattgaccgaatggcaagccaagaacaagcagatcgctggcttccctggc
gctaaagaaatcgaaagcgaagctttctggtccgtcgacatggacatcctgatcccagcc
gccctggaaggtcagatcacccgtcaacgtgcagaaatcctcagcgccaagctggtactg
gaaggggcaaacggcccaacctacccagatgcggacgacgttctgcgttcacgcaacatc
accgtagtgcctgacgttatctgtaacgccggcggcgtgaccgtcagttacttcgagtgg
gtacaggacatggccagctacttctggagcgaaagcgaaatcaacgagcgtatggacaag
atcatgaccgacgctatggttcacgtttggaacaagtccgaagagaagaaatgcagcctg
cgcaccgcggcctatatcgtcgcctgtgagcgtatcctgaccgcacgtaaagagcgtggc
atttacccaggttaa

DBGET integrated database retrieval system