KEGG   Serratia liquefaciens: M495_13550Help
Entry
M495_13550        CDS       T02740                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
slq  Serratia liquefaciens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    M495_13550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M495_13550
   00620 Pyruvate metabolism
    M495_13550
   00650 Butanoate metabolism
    M495_13550
  Lipid metabolism
   00071 Fatty acid degradation
    M495_13550
  Amino acid metabolism
   00350 Tyrosine metabolism
    M495_13550
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    M495_13550
   00626 Naphthalene degradation
    M495_13550
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     M495_13550
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M495_13550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2861262..2863934
Genome map
AA seq 890 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVEESGMG
IVEDKVIKNHFASEFIYNAYKDEKTCGILSEDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPKDIVGWIDQPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DSGVICASEQSVIVVDSIYDAVRERFASHGGYMLQGKELKAVQDIILKNGGLNAAIVGQS
APKIAEMAGIKVPASTKVLIGEVKLVDESEPFAHEKLSPTLAMYRAKDFEDAVSKAEKLV
AMGGIGHTSCLYTDQDNQPERVAFFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQITSVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVLYEHPETHFEDLALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDVTGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEYLPTSYKEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIEKLLTWLDEIKAELGIPASIREAGVLEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQIMLDTFYGRKFSEAVDEEVLAAPVVAKTVKKTKK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacaaatgtcgctgaactgaacgagctagttgcacgtgtcaaaaaagcccag
cgcgaatatgccaacttcactcaagagcaagttgataaaattttccgcgctgctgccctc
gccgctgccgatgcccgtattcctctggctaaaatggccgttgaagaatccggtatgggt
atcgttgaagataaagtgatcaagaaccacttcgcatcagagtttatctataacgcctat
aaagatgaaaaaacctgcggtatcctgtctgaagacgatactttcggtaccatcaccatc
gccgaacctatcggcctgatttgcggtatcgtacccaccaccaacccaacttccacggcc
attttcaaagcgttaatcagcctgaaaacccgtaacggtatcatcttctctccgcaccca
cgtgcgaaaaacgccaccaacaaagcggctgatatcgtgctgcaggcagcgattgccgcc
ggtgcgccaaaagacatcgtcggctggatcgatcaacctaccgttgaactctccaaccaa
ctgatgcaccaccctgacatcaacctgatcctggccaccggtggcccaggcatggtgaaa
gcagcctacagctccggcaaaccggccatcggcgtgggtgcgggtaataccccggtagtg
gttgacgaaacggcggatatcaaacgcgtcgtggcctctattctgatgtctaaaaccttc
gacagcggtgtgatttgcgcctctgagcaatccgtcatcgtggttgactccatctatgac
gcagtgcgcgaacgtttcgcatcccatggcggctacatgctgcagggtaaagagctgaag
gccgtacaggacatcatcctgaaaaacggtggcctcaatgcggctatcgtcggtcagtca
gcaccgaaaatcgctgaaatggcaggcatcaaagtcccggcaagcactaaagtgctgatc
ggtgaagtgaagctggtcgatgagtcagaacctttcgctcacgaaaaactgtcgccaacg
ctggctatgtatcgcgccaaagactttgaagacgccgtcagcaaagcggaaaaactggtc
gcgatgggcggtatcggtcacacctcttgtctgtacaccgatcaggataaccagccggaa
cgcgtagccttcttcggcgacaagatgaaaaccgcgcgtatcctgatcaacacccctgct
tctcagggtgggatcggtgacctgtacaacttcaaactcgctccgtctctgacgctgggc
tgcggttcctggggcggtaactccatctctgaaaacgtcggtccaaaacacctgatcaac
aagaaaactgtagcgaagcgagcagaaaacatgttgtggcataaacttccgaaatcaatc
tacttccgccgtggctcactgccaatcgcgctggaagaagtagcgaccgacggggcaaaa
cgcgccttcattgtgaccgaccgctacctgttcaacaacggctatgcagaccagatcacc
tccgttctgaaatcgcacggcattgaaacagaagtattctttgaagttgaagcggatcca
acgctgtccatcgtgcgtaaaggcgctgaacagatgaactccttcaagccagacgtgatc
atcgcgctgggcggcggttcaccgatggatgctgcgaagatcatgtgggtgctgtacgaa
caccctgaaacccacttcgaagacctggcgctgcgctttatggatatccgtaagcgtatc
tacaagttcccgaaaatgggcgtgaaggcaaaaatgattgccgtcaccaccacttcaggc
accggttcagaagttacgccgtttgcagtagtgaccgacgacgtaaccggccagaaatat
cctctggcggattacgcattgacaccagacatggcgattgttgacgccaacctggtcatg
aacatgccgaaatccctgtgcgccttcggtggcctggatgcggtaactcacgcgctggaa
gcttatgtttcagtcctggcgaacgaatactccgacggtcaggcgctgcaagcgttgaaa
ctgctgaaagagtatctgccaaccagctataaagaaggtgccaagaacccggtagcccgt
gagcgcgtgcacaatgctgcgaccatcgccggtatcgcgttcgccaacgccttcctcggg
gtttgccactcaatggcccacaaactgggctccgagttccatatcccacacggtttggcc
aacgccatgctgatttccaacgtcattcgctataacgcgaacgacaacccgaccaagcaa
acggctttcagccagtacgaccgcccacaagcgcgtcgccgctacgctgaaatcgctgac
catctcggcctgagcgcaccgggtgaccgtaccgcacagaaaatcgagaagctgctgacc
tggctggacgagatcaaggccgaactaggcatccctgcttcaatccgcgaagccggcgtg
ctggaagccgatttcctggcgaaagtagacaagctgtctgaagacgcctttgacgaccaa
tgtaccggtgctaacccacgttatccgctgattgctgaactcaagcaaatcatgctggat
accttctacggacgtaaattcagcgaagcggttgatgaagaggttctggccgcaccggtt
gtcgccaagacggtaaagaagaccaaaaaataa

DBGET integrated database retrieval system