KEGG   Serratia liquefaciens: M495_13555Help
Entry
M495_13555        CDS       T02740                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
slq  Serratia liquefaciens
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M495_13555
Enzymes [BR:slq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     M495_13555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2864067..2864651)
Genome map
AA seq 194 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDHRFGVGKVSSRIGLSSQAQ
LYNNDSMLFAMIAQEHQQQPVHCVLLDESQFLTKQQVEQLCDVVDQLDIPVLCYGLRTDF
LGELFIGSQYLLAWADKLVELKTICHCGRKANMVLRLDENGQAMHAGEQVVIGGNESYVS
VCRKHYKEAIQALE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattactctgctatgaatgcagggaaatctactgcgttgttg
caatcttcatataattatcaagaacgtggtatgcgtacgctggtgtttaccgccgaaata
gatcaccgttttggcgtgggtaaggtgagttcgcggatcggcctgtcttcccaggcacag
ctctacaataatgactctatgctatttgcgatgattgcccaggaacatcagcagcagcct
gtacattgcgttctgctcgatgaaagccagttcctgaccaaacagcaggttgagcaattg
tgcgatgttgtcgatcagttggatattccggtgttgtgctacggtttgcgtactgatttc
ctgggggaactatttattggcagtcaatatttgctggcttgggcggacaaactggtggag
ttgaaaaccatttgtcattgcgggcgtaaggcgaatatggtgctgcggctcgatgagaac
gggcaggcgatgcatgctggcgaacaggtggtgattggcgggaacgaaagctacgtctcc
gtctgccgtaagcattacaaagaggctatacaggccttggaatga

DBGET integrated database retrieval system