KEGG   Serratia liquefaciens: M495_15445Help
Entry
M495_15445        CDS       T02740                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
slq  Serratia liquefaciens
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:slq00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:slq00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:slq00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:slq00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:slq00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3207720..3208607)
Genome map
AA seq 295 aa AA seqDB search
MTLSVAVIGTGAIGMDLVNKIHRSPLLNCGLLAGRNKDSAGFELAAQLGCPTSAGGIDAV
LASPKPFDVVFDATNAMSHAKHWELLRPLGSLMIDLTPSHLGKMIVPTVTGTEALAERNV
SLISCGGQASIPILHALSRHFRINDIEVVATVASNILGRATRINIDEYVDTTQRALSAFT
GVANTKAILNISPAAPPAMFRVTIFAGIPGVTKEQITPVLAEAVEAVRGFSAGYSLTALN
VSEGRVSISLEVVASSKVMPEYAGNLDLINSAAILVAEQYASYRNKTEGANGHAD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgctctccgttgctgtcatcggaaccggcgctattggcatggatctggtcaataaa
attcatcgttctccgctgctcaattgtgggctgctcgcggggcgcaacaaggactccgcc
ggttttgagcttgcggcccaattggggtgtccgaccagcgccggtggcattgacgctgtt
ttggcatcgcccaaacctttcgacgtggtgtttgacgccaccaacgcgatgtcgcatgcc
aaacattgggagctgttgcgaccgttgggctccttaatgatcgacttaacccccagccac
ctgggaaaaatgattgtacccacggtaacgggaaccgaggcgctggccgagcgcaatgtc
agcctgatcagctgcggtggacaggcgtcgatacccattttgcatgccctgagccgacat
tttcgtatcaacgatatcgaggtggtggcgaccgtcgccagcaatattctggggcgggcc
acccggatcaacatcgacgaatatgtggacaccacgcagcgggcgctcagcgcttttacc
ggcgtagccaacaccaaggcgatcctcaacatcagcccggctgcgccacccgccatgttc
agggtcaccattttcgccggtattcccggggtcacgaaggaacagattactccggtgctt
gctgaggccgttgaggcggtgcggggattctcggcgggctattcgcttaccgctcttaac
gtcagcgaaggacgcgtttcgatctcgctggaggtggttgccagcagcaaggtgatgcct
gaatacgccgggaatctggatctgattaattctgccgccatcctggttgccgaacagtat
gcgagctatcgaaataaaacggagggggctaatggccatgctgattaa

DBGET integrated database retrieval system