KEGG   Serratia liquefaciens: M495_15445Help
Entry
M495_15445        CDS       T02740                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
slq  Serratia liquefaciens
Pathway
slq00360  Phenylalanine metabolism
slq00362  Benzoate degradation
slq00620  Pyruvate metabolism
slq00621  Dioxin degradation
slq00622  Xylene degradation
slq00650  Butanoate metabolism
slq01100  Metabolic pathways
slq01120  Microbial metabolism in diverse environments
slq01220  Degradation of aromatic compounds
Module
slq_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M495_15445
   00650 Butanoate metabolism
    M495_15445
  Amino acid metabolism
   00360 Phenylalanine metabolism
    M495_15445
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M495_15445
   00622 Xylene degradation
    M495_15445
   00621 Dioxin degradation
    M495_15445
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     M495_15445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh Glu_dehyd_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGQ31798
Position
complement(3207720..3208607)
Genome map
AA seq 295 aa AA seqDB search
MTLSVAVIGTGAIGMDLVNKIHRSPLLNCGLLAGRNKDSAGFELAAQLGCPTSAGGIDAV
LASPKPFDVVFDATNAMSHAKHWELLRPLGSLMIDLTPSHLGKMIVPTVTGTEALAERNV
SLISCGGQASIPILHALSRHFRINDIEVVATVASNILGRATRINIDEYVDTTQRALSAFT
GVANTKAILNISPAAPPAMFRVTIFAGIPGVTKEQITPVLAEAVEAVRGFSAGYSLTALN
VSEGRVSISLEVVASSKVMPEYAGNLDLINSAAILVAEQYASYRNKTEGANGHAD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgctctccgttgctgtcatcggaaccggcgctattggcatggatctggtcaataaa
attcatcgttctccgctgctcaattgtgggctgctcgcggggcgcaacaaggactccgcc
ggttttgagcttgcggcccaattggggtgtccgaccagcgccggtggcattgacgctgtt
ttggcatcgcccaaacctttcgacgtggtgtttgacgccaccaacgcgatgtcgcatgcc
aaacattgggagctgttgcgaccgttgggctccttaatgatcgacttaacccccagccac
ctgggaaaaatgattgtacccacggtaacgggaaccgaggcgctggccgagcgcaatgtc
agcctgatcagctgcggtggacaggcgtcgatacccattttgcatgccctgagccgacat
tttcgtatcaacgatatcgaggtggtggcgaccgtcgccagcaatattctggggcgggcc
acccggatcaacatcgacgaatatgtggacaccacgcagcgggcgctcagcgcttttacc
ggcgtagccaacaccaaggcgatcctcaacatcagcccggctgcgccacccgccatgttc
agggtcaccattttcgccggtattcccggggtcacgaaggaacagattactccggtgctt
gctgaggccgttgaggcggtgcggggattctcggcgggctattcgcttaccgctcttaac
gtcagcgaaggacgcgtttcgatctcgctggaggtggttgccagcagcaaggtgatgcct
gaatacgccgggaatctggatctgattaattctgccgccatcctggttgccgaacagtat
gcgagctatcgaaataaaacggagggggctaatggccatgctgattaa

DBGET integrated database retrieval system