KEGG   Serratia liquefaciens: M495_16835Help
Entry
M495_16835        CDS       T02740                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
slq  Serratia liquefaciens
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M495_16835
  Amino acid metabolism
   00380 Tryptophan metabolism
    M495_16835
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     M495_16835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3508640..3510076
Genome map
AA seq 478 aa AA seqDB search
MSKKGLTTAAGAPVVDNNNVITAGKRGPMLLQDVWFLEKLAHFDREVIPERRMHAKGSGA
YGTFTVTHDITQYTRAKIFSEIGKQTDMFIRFSTVAGERGAADAERDIRGFAMKFYTEEG
NWDLVGNDTPVFYLRDPLKFPDLNHVVKRDPRTNLRNPTYKWDFFSLSPESLHQLTIDFS
DRGIPKSYRHMHGFGSHTFSFINANNERFWVKFHFRCEQGIENLMDDEAEAIIAKDRESS
QRDLYEAIERGDYPRWKLQIQIMPEHEASQTPYNPFDLTKVWPHGDYPLIDVGFFELHRN
PENYFAEVEQVALNPANVVPGVSFSPDKMLQGRLFSYGDAHRYRLGVNHHQIPVNGAKCP
FHNYHRDGAMRVDGNSGNGATYEPNSFGLFQEQPDFREPPLSIEGAADHWNHREDGDYFS
QPRALFNLLSAEEHQRMFTRIAGELSQVPEQIQRRQVDLFTQVHPDYGAGVAKALGLK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaaggactgaccaccgcagccggagccccggttgtcgataataataacgtg
atcaccgcaggtaaacgcggcccgatgttgctgcaggacgtttggttcctggaaaagctg
gctcacttcgaccgtgaagtgatccccgagcgccgcatgcacgccaaaggatccggcgcc
tacggcacttttaccgtcacccacgatattacccagtacacccgcgcaaaaatcttctct
gaaatcggcaagcaaactgacatgtttatccgcttctccaccgtagccggtgaacgcggg
gccgccgacgccgaacgcgacattcgcggtttcgcgatgaagttttataccgaggagggc
aattgggacctggtgggtaacgacaccccggtgttttacctgcgcgacccgctgaaattc
cccgatcttaaccacgtggtcaaacgcgatccgcgtaccaatctgcgcaacccgacttat
aaatgggatttcttctcgctgtcgccggaaagcctgcaccaattgaccatagacttcagc
gaccgcggcatcccgaaatcctaccgccatatgcacggcttcggcagccataccttcagc
tttatcaatgccaacaatgaacgcttctgggttaaattccacttccgctgcgaacaaggc
attgaaaacctgatggatgacgaagccgaggcgatcattgccaaagaccgtgaaagctca
cagcgcgatttgtatgaagccatcgagcggggtgattacccgcgctggaaactgcagatt
cagatcatgccggaacacgaagcctcgcagacgccttacaaccccttcgatctgaccaag
gtatggccgcacggcgattacccgttaatcgacgttggcttcttcgagctgcaccgcaac
ccggaaaactacttcgcggaagtggaacaagtggcgttgaacccagccaacgtagtgcct
ggggtcagcttctcgccggataaaatgctgcagggtcgcctgttctcttacggggatgcc
caccgctaccgtctgggcgttaaccatcatcaaatcccggttaacggtgcaaaatgcccg
ttccacaactaccaccgcgacggcgcgatgcgcgtggacggcaacagcggtaacggcgcg
acctacgagccaaacagctttggcttgttccaggagcaaccggactttagagagccaccg
ttgagcattgaaggagctgccgaccactggaatcaccgtgaagacggggattacttcagc
cagccgcgcgcgctgttcaacctgttgagcgcggaagaacatcagcgtatgttcacccgt
atcgccggtgagctgtcgcaggtgccggaacagatccagcgccgtcaggtcgatttgttc
acccaagtgcatccggattacggcgctggcgtagccaaagcgctggggctgaaataa

DBGET integrated database retrieval system