KEGG   Serratia liquefaciens: M495_20320Help
Entry
M495_20320        CDS       T02740                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
slq  Serratia liquefaciens
Brite
Enzymes [BR:slq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     M495_20320
Secretion system [BR:slq02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   M495_20320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4250028..4250744)
Genome map
AA seq 238 aa AA seqDB search
MKKGLMLLSLLVASVTGAAHADDAAIQKALGSLGIQQADVQPSPVNGLKTVLTDNGVLYV
SEDGKHILQGPLYDVSGKEPVNVTNQLLTGKLEALKDQMIVYKAPKQKHVITVFTDITCG
YCHKLHEQMKEYNDLGITVRYLAFPRQGLNSQAEKDMQSIWCTADKAKAFDQAMKGDAVS
PATCKTDISKHYALGVQFGIQGTPAIILENGMMIPGYQGPKEMAAMLDAHQTATKTGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggtttaatgctgctctctctgctggtggcttctgtgaccggcgcggcccat
gccgacgatgcggcaattcaaaaagcgcttggcagcctgggcattcagcaggcggacgtg
cagccttcaccggtgaacggcctgaaaactgtgctgaccgataacggcgttctgtacgtg
agcgaagacggcaaacacattctgcaaggcccgctgtacgacgtcagtggcaaagagccg
gtcaacgtcaccaatcaactgctgaccggcaaattggaagcgctgaaagatcagatgatc
gtttataaagcgccgaagcaaaagcacgtgatcaccgtttttaccgatatcacctgcggc
tattgccacaaacttcacgagcagatgaaagagtataacgatctgggcattaccgtccgc
tatctggcgtttccgcgtcaggggttgaattcccaggccgaaaaagacatgcagtccatc
tggtgtaccgctgataaagccaaagctttcgaccaggcaatgaaaggcgacgcagtatcc
ccggcaacctgtaaaaccgacatcagcaaacactacgcgctcggcgtgcagttcggcatt
cagggtaccccggcgatcattttggaaaacggcatgatgatcccaggttatcagggaccg
aaagagatggccgccatgctggacgcacatcagaccgcaactaaaaccggtggttaa

DBGET integrated database retrieval system