KEGG   Serratia liquefaciens: M495_23355Help
Entry
M495_23355        CDS       T02740                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
slq  Serratia liquefaciens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:slq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4902199..4904289)
Genome map
AA seq 696 aa AA seqDB search
MDRKVIDQAAAQAGIAADYINAHGQQQAIAEDTKRRLLDAMGRSASPQEPAVTPLPAVKV
FYQGAPVALPLAGSGEYQWTLLREDGGRQQGRASARKTFTLPAELPTGYHQLTLTQGEQQ
WQCRLIVAPKRCFEPDALLTGKKLWGACVQLYTLRSDRNWGIGDFGDLRQMVEQVGERGG
AFVGLNPIHSLYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRNEAAQQWWLKPATQK
KLAEARASDRVDYGKVTQLKLAALQLAFPLFQARKAADSQRQAFEQFVIDGGESLYQQAA
FDALHAHLAAADDSLWGWPAWPEEYQQGDSAAVKQFCQQQQEQVQFYLWLQWLAASQFAD
CFRQSQQQQMPIGLYRDLAVGVAEGGAETWCERELYCLKASVGAPPDILGPLGQNWGLPP
MDPHVMAARGYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGETAVHGAYVKYPVDD
LLAVLALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLYFERDGENHFRAPQAYP
VQAMATITTHDLPTLRGYWQSGDLKLGNKLGLYPDAEILKELFADRERAKQGLLDGLHHY
GCVPQKVGKKAALLNMSPLLNRGLQRYVADSASALLGLQPEDWLDMADPVNIPGTSDQYP
NWRRKLTKTLEEMFADQQVNRLLKDLDKRRRKVSVG
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcaaggtcatcgatcaggcggcagctcaggcgggtatcgctgccgattatatt
aacgcccatggtcaacagcaggcgatcgctgaagacaccaagcgcaggctgctggacgcc
atgggccgaagcgcgtcaccgcaggagcctgcggtgacgccgctgccggcggtgaaggtg
ttttatcagggcgcgccggtggcattgccgctggcgggcagcggtgagtatcagtggacg
ctgctgcgcgaagacggcggccggcagcaaggccgtgccagcgcacgcaaaacgttcacc
ctgccggctgaattgccaacgggctatcatcaactgacgctgacacagggtgaacagcag
tggcagtgccggttgattgtggcgccgaaacgctgcttcgaaccggatgccttgttgacc
ggcaagaagctgtggggcgcttgcgtccagctttacactcttcgctccgatcgcaactgg
ggcatcggtgactttggcgacttgcgccagatggtggagcaggtcggtgaacggggcggc
gcttttgtcgggctgaatccgattcactcgctgtacccggctaacccggaaagcgccagt
ccgtatagcccgtcgtcgcgacgctggttgaacgtcatctatattgacgtgaacgcggtg
gaggatttccagcgcaacgaagccgcccagcaatggtggctgaaaccggcaacgcaaaaa
aagttggccgaggcccgtgccagcgatcgggtggattacggcaaggtgacgcagcttaag
ctggcggcgttgcaactggcattcccgctgttccaggcgcgtaaagccgctgactctcag
cgtcaggcattcgagcagtttgttatcgacggcggcgaaagtttgtatcagcaggcggca
ttcgacgcgctgcatgctcatcttgcggctgcggatgacagcctgtggggctggccggcc
tggccggaagaatatcagcagggtgatagcgctgcggtaaagcaattttgtcagcagcag
caagaacaggtgcaattttacctgtggctgcagtggttggctgccagtcagttcgccgat
tgtttccgccaaagtcagcaacagcagatgccgattggcctgtatcgcgatctggcggtc
ggcgtggcggaaggcggcgcggaaacctggtgcgaacgcgagctgtattgcctgaaggcc
tcggttggcgcaccgccggacattctcgggccgctggggcaaaactgggggctgccgccg
atggatccgcatgtgatggcggcgcgcggctatcagccgtttatcgatctgctgcgcgcc
aatatgaccagctgtggtgcgctgcgtattgatcatgtgatggcgttactgcgtttatgg
tggatcccttacggtgaaaccgccgttcacggcgcctacgtgaaatacccggtcgatgat
ctgctggcggtgctggcgctggaaagtcaacgtcaccgctgcatggtgattggcgaggac
ctcggtaccgttccggtggaaatcgtcggcaagctgcgcgacagcggcgtttattcctac
aaggtgctgtacttcgaacgcgacggcgagaaccacttccgcgccccgcaggcctatccg
gttcaggcgatggcgaccatcaccacgcacgacctgccgacgctgcgcggctattggcaa
agtggcgatctgaagctcggcaacaagctggggttgtatccggatgcggagatcctgaaa
gagctgttcgccgatcgcgaacgtgccaaacaggggctactggatggcttgcatcactat
ggctgtgtgccgcagaaagtgggcaaaaaggcggcgttgttgaatatgagcccgctgctt
aatcgtggtttgcagcgctatgtcgccgacagcgccagcgccttgctgggtctgcagccg
gaagactggttggatatggcggatccggtcaatattcccggcaccagcgatcagtaccca
aactggcggcgaaaactgaccaaaacgctggaagagatgtttgccgatcagcaggtcaat
cgcctgctgaaggatttggacaagcggcgtcgcaaggtctcggtggggtaa

DBGET integrated database retrieval system