KEGG   Serratia liquefaciens: M495_23645Help
Entry
M495_23645        CDS       T02740                                 

Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
slq  Serratia liquefaciens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    M495_23645
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M495_23645
   00330 Arginine and proline metabolism
    M495_23645
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     M495_23645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4975813..4977156
Genome map
AA seq 447 aa AA seqDB search
MENTVSVESFLSSLQQHNPHQPEFLQAVREVFTSLWPFIERNPRYREYALLERLVEPERT
IQFRVSWVDDRGQVQVNRAWRVQFNSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALT
TLPMGGGKGGSDFDPKGKSQAEIMRFCQALMTELYRHLGPDTDVPAGDIGVGGREVGFMS
GMMKKLSNNTACVFTGKGLSFGGSLIRPEATGYGLVYFTDAMLQRHGLGFEGMRVAVSGS
GNVAQYTIEKALELDARVITVSDSGGTLVDEAGFTTEKLAHLVEIKNQRYGRVEDYARER
GLTYLAGQQPWNVPVDIALPCATQNELDLAAAQTLIRNGVKAVAEGANMPTTIQATDAFL
DAGVLFAPGKAANAGGVATSGLEMAQNAARIGWRAEKVDVRLQHIMADIHHACVEYGGEG
KQTHYVHGANIAGFVKVADAMLAQGVL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataccgtatcggtagagtctttcttgtcctcgcttcaacaacataatccccat
cagccggaatttttacaggcggtcagggaagtcttcacttcgctgtggccttttatcgag
cgtaatccgcgctatcgcgaatacgcgctgctggagcgtttggtagagcccgagcgtacc
atccagttccgcgtcagttgggtcgacgatcgcggccaggtgcaggtcaaccgcgcctgg
cgcgtgcagttcaactccgccatcgggccttataaaggcggcatgcgctttcatccttcg
gtcaatttgtcgattctgaagttcctcggcttcgaacagacgtttaaaaacgccctgacc
accctgccgatgggcggcggaaaaggcggttcggactttgatcccaaggggaaaagccag
gcggagatcatgcgtttctgccaggcgctgatgactgaactgtaccgtcacctcgggccg
gataccgacgtgcccgccggcgatatcggcgttggcggccgtgaggtcggctttatgagc
ggcatgatgaaaaagctgtccaacaacaccgcctgcgtgttcaccggcaaggggctgtca
ttcggcggcagcctgatccgtccagaggccaccggctatgggctggtctatttcaccgac
gccatgctgcaacgtcacgggttgggttttgaaggcatgcgggttgcggtttctggttca
ggtaacgtggcgcaatacaccattgagaaggcactggagctggatgcgcgcgtgatcacc
gtatcagactctggcggtactctggtcgatgaagccggctttaccaccgaaaaactggcc
catttggtggagatcaagaatcagcgctatggtcgagtggaagattatgcccgcgaacgt
ggcctgacctatctggccggccagcagccctggaacgtgccggtggatatcgccctgccg
tgcgccacccaaaacgagctggatttggctgccgcacagacgctgatccgcaacggggtt
aaagctgtggcggaaggcgcaaatatgccgaccaccattcaggcgaccgatgcattcctg
gacgccggggtgctgtttgcgccgggcaaggcggccaacgccggtggggttgccacctcc
gggctggagatggcgcagaacgccgcgcgcatcggctggcgcgccgagaaagtggatgta
cgtttacaacatatcatggcggatattcatcacgcctgcgtggaatacggcggcgagggt
aagcaaacccactacgtacacggcgccaatatcgccggattcgtcaaggtagccgacgcc
atgctggcgcagggcgtgttgtaa

DBGET integrated database retrieval system