KEGG   Salinispira pacifica: L21SP2_0145Help
Entry
L21SP2_0145       CDS       T03013                                 

Definition
(GenBank) Neopullulanase (EC:3.2.1.135)
Organism
slr  Salinispira pacifica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
164303..165775
Genome map
AA seq 490 aa AA seqDB search
MTFSVSWNMARKALLLLLILSASVFNLWGQFGPEDSVYFLFTDRFYDGDESNNYTVNIRN
LKGYHGGDFAGLTEKLPYIAGMGFSAIWISSVVDNQAGGYHGYWAQDYYRVEEHFGDMES
LKTMVDRAHELGIKVILDLAINHTGIQHDFFGDPAYQDWFHPRQDIDDYSDQYQVENHWL
QNLPDLNHENPEVRQYLIDMSIWWIEQTGIDGYRLDALRHVPADFWREYSAAVKEQFPDF
YLIGEVFDGNPANLGKYQNAGIDGLLDFPAYFAIQDMVRNGEPATRFAQSVINSKRNYPH
EELMGTFIDNHDVRRFVNQVYRNREEKLAQSLMFLFSYTGIPIMYYGTEIPMDGGSEHSG
RSLMAWDEPALYKDLVTSLNELRSLHPALSSGEFTIVDRSMSRFVYARHDADDVFLTILN
NGDEERFSIELPDELRRDFRWARSMVLDSAGEPLAPGVPELESIRIRRGRLRMELPAYTG
VVLKLSRERE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacgttttctgtttcatggaacatggcccggaaagctttgcttctgctgctcattcta
tctgcatcagtttttaatctgtggggccagttcggacccgaggactcggtctatttcctg
tttaccgaccgcttttatgacggtgatgagagcaataactatacggtgaacatcagaaat
ctgaaggggtaccatggaggggattttgccggactgacggagaagctcccgtacatagcc
gggatgggcttcagcgcaatctggatatcttccgtggtggataaccaggccggaggatac
cacggttactgggcacaggattattaccgggttgaagaacatttcggtgatatggaaagt
ctgaaaaccatggttgaccgggctcacgagctgggtattaaggtgatcctggatctggcc
ataaatcacaccgggattcagcacgattttttcggggatcctgcataccaggactggttt
catccccggcaggatattgatgattactccgatcagtatcaggtggaaaaccattggctt
cagaatcttccggatctgaatcatgagaaccccgaggtgcgtcagtaccttatagatatg
tccatctggtggattgagcagaccggcattgacggataccgcctggatgccctgaggcat
gttcctgcggatttctggagggaatactccgccgccgtcaaggagcagtttccggatttc
taccttatcggcgaggtgtttgacggcaaccccgccaacctgggcaaatatcagaatgcg
ggaatcgacggacttctggatttccccgcatattttgcaattcaggatatggtgcgtaac
ggcgaacccgccacccgttttgcccagtctgtcatcaattccaaacggaactatccccat
gaagagcttatgggaacctttatagacaaccatgatgtgcgacgcttcgtgaaccaggtg
taccggaacagagaggagaagctcgcccagtccctcatgtttctgttcagctacacgggc
ataccaattatgtattacggcacggaaattcccatggacggcggttccgaacattcgggc
aggagtctcatggcctgggacgaacccgccctctacaaagatcttgtgacatctttgaat
gaactgcgaagtctccatcctgctctcagcagcggcgaattcaccattgtggaccggagt
atgagccgctttgtgtatgcccgccacgatgcggatgatgtttttctcacaattctgaat
aatggcgatgaagagcgtttttccattgaacttcccgacgaattgaggcgggatttccga
tgggcccgcagcatggttctggattcagccggcgaacccctggcgccgggtgttccggag
ctggagagcatccggattcgtcggggccgcttgaggatggaacttcccgcctatacgggg
gtggttttgaaactcagcagggaaagagagtaa

DBGET integrated database retrieval system