KEGG   Spirochaeta sp. L21-RPul-D2: L21SP2_0145Help
Entry
L21SP2_0145       CDS       T03013                                 

Definition
Neopullulanase (EC:3.2.1.135)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
slr  Spirochaeta sp. L21-RPul-D2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L21SP2_0145
Enzymes [BR:slr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     L21SP2_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
164303..165775
Genome map
AA seq 490 aa AA seqDB search
MTFSVSWNMARKALLLLLILSASVFNLWGQFGPEDSVYFLFTDRFYDGDESNNYTVNIRN
LKGYHGGDFAGLTEKLPYIAGMGFSAIWISSVVDNQAGGYHGYWAQDYYRVEEHFGDMES
LKTMVDRAHELGIKVILDLAINHTGIQHDFFGDPAYQDWFHPRQDIDDYSDQYQVENHWL
QNLPDLNHENPEVRQYLIDMSIWWIEQTGIDGYRLDALRHVPADFWREYSAAVKEQFPDF
YLIGEVFDGNPANLGKYQNAGIDGLLDFPAYFAIQDMVRNGEPATRFAQSVINSKRNYPH
EELMGTFIDNHDVRRFVNQVYRNREEKLAQSLMFLFSYTGIPIMYYGTEIPMDGGSEHSG
RSLMAWDEPALYKDLVTSLNELRSLHPALSSGEFTIVDRSMSRFVYARHDADDVFLTILN
NGDEERFSIELPDELRRDFRWARSMVLDSAGEPLAPGVPELESIRIRRGRLRMELPAYTG
VVLKLSRERE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacgttttctgtttcatggaacatggcccggaaagctttgcttctgctgctcattcta
tctgcatcagtttttaatctgtggggccagttcggacccgaggactcggtctatttcctg
tttaccgaccgcttttatgacggtgatgagagcaataactatacggtgaacatcagaaat
ctgaaggggtaccatggaggggattttgccggactgacggagaagctcccgtacatagcc
gggatgggcttcagcgcaatctggatatcttccgtggtggataaccaggccggaggatac
cacggttactgggcacaggattattaccgggttgaagaacatttcggtgatatggaaagt
ctgaaaaccatggttgaccgggctcacgagctgggtattaaggtgatcctggatctggcc
ataaatcacaccgggattcagcacgattttttcggggatcctgcataccaggactggttt
catccccggcaggatattgatgattactccgatcagtatcaggtggaaaaccattggctt
cagaatcttccggatctgaatcatgagaaccccgaggtgcgtcagtaccttatagatatg
tccatctggtggattgagcagaccggcattgacggataccgcctggatgccctgaggcat
gttcctgcggatttctggagggaatactccgccgccgtcaaggagcagtttccggatttc
taccttatcggcgaggtgtttgacggcaaccccgccaacctgggcaaatatcagaatgcg
ggaatcgacggacttctggatttccccgcatattttgcaattcaggatatggtgcgtaac
ggcgaacccgccacccgttttgcccagtctgtcatcaattccaaacggaactatccccat
gaagagcttatgggaacctttatagacaaccatgatgtgcgacgcttcgtgaaccaggtg
taccggaacagagaggagaagctcgcccagtccctcatgtttctgttcagctacacgggc
ataccaattatgtattacggcacggaaattcccatggacggcggttccgaacattcgggc
aggagtctcatggcctgggacgaacccgccctctacaaagatcttgtgacatctttgaat
gaactgcgaagtctccatcctgctctcagcagcggcgaattcaccattgtggaccggagt
atgagccgctttgtgtatgcccgccacgatgcggatgatgtttttctcacaattctgaat
aatggcgatgaagagcgtttttccattgaacttcccgacgaattgaggcgggatttccga
tgggcccgcagcatggttctggattcagccggcgaacccctggcgccgggtgttccggag
ctggagagcatccggattcgtcggggccgcttgaggatggaacttcccgcctatacgggg
gtggttttgaaactcagcagggaaagagagtaa

DBGET integrated database retrieval system