KEGG   Spirochaeta sp. L21-RPul-D2: L21SP2_0766Help
Entry
L21SP2_0766       CDS       T03013                                 

Definition
O-Glycosyl hydrolase family 30
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
slr  Spirochaeta sp. L21-RPul-D2
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    L21SP2_0766
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    L21SP2_0766
Enzymes [BR:slr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     L21SP2_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812291..813670
Genome map
AA seq 459 aa AA seqDB search
MNIDKFILSSKDGGQKLQQTNPGDYISPLPENGKASADIETDLNRTRQEIMGFGGAFTEA
AALSLSKLNPRLREEALEAYFHPERGHGYSLGRVHIHSCDFALSNYTYVEEHDESLDSFD
ISHDREHIIPMIRDAFRMASKDLKLLASPWSPPGWMKTNGEMNNGGKLLPRYRDAWARYY
VKFIRAYDQEEIPLWGISVQNEPAAVQIWDSCIFSGEEERDFVRDHLGPCLRENGLKDIK
LLIWDHNRDIMAERAEAVLSDPEAAQYVWGTGYHWYVSEEFSNLSRVHDAFPDKHLLFTE
GCQEGGCKIGEWFTGERYARNMIGDFNNWCEGYIDWNLVLDETGGPNHVNNLCDAPIIAD
TLNDRLIYNSSYYYIGHFSRFVPPGSKALELSRKATGAASHAGEEDRILWAAFLRPDGSI
AAVAMNEGDDGQSSTLRIGAQGFELRLPAHSIATIILKA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagacaaatttattctcagctccaaagatggaggccagaagcttcaacagaca
aatccgggagattatatttcacctctcccggagaatggaaaggcttctgcagatattgaa
acagacctgaaccgaacccgtcaggagattatgggattcggcggcgcctttacggaagcc
gccgcactgagtctttcgaaattgaatccccggctgagagaggaggctcttgaggcctac
ttccaccctgagcggggtcatggatattccctgggcagagtgcacattcacagctgcgac
tttgccctctccaattacacctatgtggaagaacacgatgagagtctggatagcttcgat
atttcccatgaccgtgagcatattattcccatgatccgggatgccttccgcatggcatcg
aaagatctgaaattactggcctctccctggagtcctccgggctggatgaaaaccaacggg
gagatgaacaacggagggaaactgcttccccggtaccgggatgcctgggcccggtactat
gtgaaatttatccgggcatatgatcaggaagaaattccgctgtggggcatcagcgtacag
aatgaacctgctgcggtacaaatctgggattcctgcatattttccggagaagaagagcgg
gatttcgtgcgtgaccacctgggaccctgtctccgggaaaacggtctgaaagatatcaag
ctgctgatctgggatcataacagggatattatggcggagcgggctgaagccgtgctctcg
gaccctgaggcagcccaatatgtgtggggtacgggataccactggtatgtatccgaagag
ttctccaatctgtcccgtgtacacgatgcatttcccgataagcatcttctgtttaccgaa
gggtgtcaggaaggggggtgcaaaatcggcgaatggttcaccggggaacgctacgcccga
aatatgatcggcgacttcaacaactggtgtgaaggatatatcgactggaatctggtgctg
gatgaaaccggcggcccgaaccatgtgaacaatctctgcgatgctccgattatcgccgac
accctgaacgacaggctgatatataactcatcctactactacatcggtcatttcagccgc
tttgttcccccgggatccaaagcccttgaactctcccggaaagcaaccggagccgcttcc
catgccggagaagaggaccggatcctttgggctgcgttcctgcgccccgacggctccatt
gcggctgtggcaatgaacgaaggcgatgacgggcaaagcagcactctgagaatcggagcg
cagggcttcgaattgagacttcccgcacacagtatcgccaccataatcctgaaagcctga

DBGET integrated database retrieval system