KEGG   Spirochaeta sp. L21-RPul-D2: L21SP2_1514Help
Entry
L21SP2_1514       CDS       T03013                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
slr  Spirochaeta sp. L21-RPul-D2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:slr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    L21SP2_1514
Enzymes [BR:slr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     L21SP2_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1609931..1610803
Genome map
AA seq 290 aa AA seqDB search
MRILNYGSLNVDHVYSVPHIVRPGETLAGESLNFFAGGKGANQSVAIAKAGGDVWHAGKL
GGDADWLLEKLQQFDVKTDYVTQDDGLSGHAIIQVSSQGENSIVLYGGGNQRITKEEIDA
TLVLFSRGDVLVLQNEINNIPHIMEKGLAQGLKIAVNPAPFTPDVSRWPLDKVHTLVVNE
TEAAGIVQSDASPGSTLDMLTRRYPETEIVLTLGSKGAWYAKGRKRAFVESRKVNAVDTT
AAGDTFLGYYLVERFAGASPERAMDLAAEAAAITVSRPGAMESIPFRSEL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatactgaactacggatctctcaatgttgatcatgtgtattccgtccctcacatc
gttcgtccgggagaaacccttgccggagagtcgctgaacttctttgccggcggaaaaggg
gccaatcaatccgttgccatcgccaaggcgggaggcgatgtatggcatgccgggaaactg
ggcggggatgcggactggctgcttgagaaactgcagcagtttgatgtgaaaaccgattat
gttacccaagatgacggtctcagcggtcatgccataattcaggtcagctcccagggggaa
aattccattgtgctgtatggaggcggcaatcagcgtataaccaaggaagagatagacgca
accctggtcctgttctcccggggggatgtgcttgtgctgcagaatgaaatcaacaatatc
ccgcatatcatggaaaagggccttgcccagggcctgaagattgctgtgaaccccgcaccc
ttcaccccggatgtttcccgttggccccttgataaggtgcatacattggtggtgaacgaa
actgaggcagccggaatcgtccaatccgatgcttcccccggcagcaccctggacatgctg
acccggcgctatcccgaaaccgagattgttctcaccctgggaagcaagggggcatggtat
gcaaagggcaggaaaagagcttttgtcgaaagcaggaaggtgaatgcagtggataccacc
gccgcaggagacaccttcctgggatactatctggtggaacgtttcgccggcgcttccccg
gaacgggctatggacctggcagctgaagccgcagccattaccgtgtcccgtcccggagcc
atggaatcaattcctttccgcagcgagctctga

DBGET integrated database retrieval system