KEGG   Spirochaeta sp. L21-RPul-D2: L21SP2_2608Help
Entry
L21SP2_2608       CDS       T03013                                 

Definition
Phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
slr  Spirochaeta sp. L21-RPul-D2
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:slr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    L21SP2_2608
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    L21SP2_2608
  Energy metabolism
   00680 Methane metabolism
    L21SP2_2608
Enzymes [BR:slr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     L21SP2_2608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2791481..2794240
Genome map
AA seq 919 aa AA seqDB search
MNTLSAFQEHVGMKYQIYNGLFLNLPFPDVKSSGILLPVFTSYCHDALEEGTPPIELVEE
FFSQRVGTDSFRDLKNDLFRFLRLAERQVVLFDAMEDSAFTRIVDTQGPGSIKDTLNRVE
RSEIVDDYQKLLDEYRVRIVLTAHPTQFYTDQVLSILVDLVDSLQKNDIQEINNLLLQMG
NTRFKKQKKPTPLDEAQSLMWTLENVMYSVIPKLHAHLVEDICPDEDAALNLPSIIELGF
WPGGDRDGNPFVNHEITTEVGQMLRRKVLGSYLEDARDLTRRLTFDGVLERIQGVVDKLD
STLNPVGRYLNVQKLYEAKQVDGKVFHVEVSDEGYNSAEELLEELFEIRSLVIREHNGLF
VQLLNRFIYKIQCFGFHFASLDIRQDSAVHTSLCADILEGVDAKRWGKLKELEGKVLDGK
SYEDLSDQKRVEALLLSAEALSKLEHQSRQQLLEEILDSRSDAISRDCLQSFKAIHEIQS
RNGEKGAHRYVISHTERSSHVLEVWFLSLLSGFDPDILPLDIVPLFETVEDLHNAPGIMN
RLYEIPEYSRHLKNRDRHQHIMLGFSDGTKDGGYVTANWEIYKAKEILTQTTGDHGFRVL
FFDGRGGPPARGGGNTHKFYRGLGSKIDSKTIQLTIQGQTISSSYGTEDIAAHNLGQLVS
AGLENNLFPSDSMYLNEEERDLIERLSERANAHYMALRNHPKFLPYLEHMTPLSYYGRTN
IGSRPSKRSKSGPLNLDSLRAIPFVGAWSQMKQNIPGYYGLGTALEELIKQGEQEKLQKL
YHNSLFFRTLMENSMQSLSKSYFPLTSYLNDDPEYGEFWNILKSEAELSTKNLFAITGQN
SLLDTDQVIRESIRMRERLILPVIVIQQYALQKIRQLQEEAGVETRRFVESDREKQKDVL
EKLIIKSLMASINASRNSV
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctttctgcatttcaggaacatgtgggcatgaagtatcagatatataacggt
ttatttctgaacctgcccttcccggacgtgaaaagttcgggcattcttctgccggttttc
acctcatactgtcatgatgccctggaagaaggcacaccgcccatagaactggtggaggag
tttttctcccagcgggtgggtaccgactcgttcagagatttgaagaatgatcttttccgc
ttcctcagactggcagaacgtcaggttgtactctttgatgcaatggaggattctgccttc
acccgcatagtggatacccaggggccgggatccatcaaggacaccctcaacagggttgag
cgaagcgaaatcgtggatgattatcagaaactgctggacgagtaccgggtacgtatcgta
ctcaccgcccatcccacccaattttataccgatcaggtgttgagtattctggtggacctg
gtggattcccttcagaaaaatgacattcaggagattaacaatctccttctccagatgggc
aacacccggttcaaaaaacagaaaaagcccacgccccttgatgaagcccagtctctgatg
tggactctggaaaacgtgatgtacagcgttatcccaaagcttcatgctcatcttgttgag
gatatctgtcctgacgaggatgcggcattgaatttgccgtccattattgaactgggtttc
tggcccggcggagaccgggacggcaaccctttcgtaaaccatgagatcaccacagaggtg
gggcagatgctccgacggaaggtgctgggcagttacctggaagacgcaagggatcttacc
cgacggctaaccttcgacggcgtactggagcgcatccagggcgttgtggacaagctggac
agcaccttgaacccggtgggcagatatctgaatgtacagaagttatatgaagccaaacag
gtggacggtaaagtgttccatgtggaagtttcggatgaaggatacaacagcgccgaggag
ctgcttgaggaactgtttgaaatccgcagcctggttatccgggagcacaacggtcttttt
gtacagcttctgaaccggtttatctataaaatacaatgctttggatttcattttgccagc
ctggatatccggcaggattcggcggttcacacgtcgctgtgcgcagacattcttgaagga
gtggatgcaaagcgctggggtaagctcaaggagcttgaaggcaaggttcttgacggcaag
agctatgaagaccttagtgatcaaaaacgggtggaagccctcctgctcagtgcagaagcc
ctgagcaagcttgaacatcagagcagacagcagcttctggaggagatcctggacagcaga
agcgatgccatcagcagggactgtctccagagtttcaaggcgatccatgaaatccagtca
cgaaacggggagaaaggcgcccatcgttatgtgatcagtcacaccgagcgttcaagccat
gtgctggaagtgtggttcctctcccttctcagcggttttgatccggatatacttcccctg
gatattgtacctctgtttgaaacggtggaagatctccacaatgcaccggggattatgaac
cgtctctatgaaattccggagtattcacggcatctgaaaaatcgggaccgtcatcagcac
atcatgctgggattctccgacggtaccaaagacggcggatatgtaacagccaactgggag
atctacaaggccaaggaaatcctcacccagactaccggtgatcatggcttcagggtgctg
ttttttgacggccggggtggtcctcctgcacggggcggcggcaacacccacaaattttac
cggggtctgggaagtaaaattgactccaaaaccattcagctcacaattcagggacagacc
atcagctccagttacggcaccgaagatattgccgcccataacctgggccagctggtgagc
gcaggtcttgaaaacaacctctttccctccgacagcatgtacctgaacgaagaggagagg
gatctcatcgagcgtctgtcggaacgggcgaacgcccactacatggcattacgaaatcat
ccgaaattcctgccctatcttgagcatatgaccccactgagctactacggtcgaaccaat
atcggaagccggcccagcaagcgcagtaaatccggaccattgaacctggatagtctcaga
gccatccccttcgtcggtgcctggagccagatgaagcagaacattcccggctactacggc
ctggggacagcgctggaggaactgatcaaacagggtgagcaggaaaaacttcaaaagctg
taccataacagtctctttttccgaaccctgatggaaaattccatgcagagtttgagtaaa
tcctattttccactcacttcctacctgaatgatgatcccgagtacggcgagttctggaat
attctgaaaagcgaggcggaactcagcacgaaaaatcttttcgccattaccggccagaac
agcctgctggataccgatcaggtgatccgggaatccatcaggatgcgtgagcgtctgatt
cttccggtaatcgtcattcagcagtatgccctgcagaaaatccgtcagcttcaggaagag
gccggagtggaaacccggcgtttcgtggaaagcgaccgggagaaacaaaaggacgttctg
gaaaagctgatcatcaaaagcctgatggcctccatcaacgcatccagaaactcggtatag

DBGET integrated database retrieval system