KEGG   Spirochaeta sp. L21-RPul-D2: L21SP2_2946Help
Entry
L21SP2_2946       CDS       T03013                                 

Definition
Trehalose synthase (EC:5.4.99.16)
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
slr  Spirochaeta sp. L21-RPul-D2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    L21SP2_2946
Enzymes [BR:slr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     L21SP2_2946
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     L21SP2_2946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3173298..3175112)
Genome map
AA seq 604 aa AA seqDB search
MGAENISFTDYETMWRNVYEGVVPDGRWKQECRETWELLQASGAPGRVVRKTDQASSLPA
THPWYEDLVVYALYAQHFNENISGIISRLDYLAELGVNCLWLLPVLSSPMKDEGFDISDY
RSIRKNLFQEGLDELKRREIFDEFIRKAAERGIAIIFDVAVNHVSSQHDWFQNALKAEDN
PYRDYFIWSEDNRGYSQARIIFKGMLDSNWTYSPAADKYYFHRFYPHQPDLNYRNPRVLS
EIIRVFSYWIQRGIRGFRLDAAPYLWKEEGTNCENLGKTHDIIKILRKSVELIQEDVLLL
AEACQPPREVVSYFGDNDECQAAYHFPLMPRMYRSILQESAEPIVDVMKPGVTPAISREN
QWFTFLRLHDELTLEMVSPEEREFLHGKLCKRPEWDFRNGEGISARLAELFDTPREVLFA
HLLLLGMSGNPVIYYGDEVLEGNNVEFARYQQEHTGFVDSRNLVRGPLNWNRIDGRLADG
SSDEAWHYRNMAAAIHCRLSHPQISNAAGEEREVINDSRGSAIGLKLIKEDGFELYYNLS
QSRELSIELPASHRPILSWSGLRENDLESEVNPHDPEAGTVPSGDPKEASRIQLPPRGVL
WVSV
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgctgaaaatatatcgtttaccgattatgaaaccatgtggcggaatgtgtatgag
ggagtggttcccgacggaaggtggaaacaggaatgccgtgaaacctgggaactgcttcag
gcctcaggagctcccggcagggtggtccgcaagaccgaccaagcatcctccctcccggca
actcatccatggtacgaagacctggtggtgtatgccctctatgcccagcatttcaatgaa
aacatcagcggcattatttcccgtcttgattatcttgccgagctgggggtgaattgcctc
tggcttctgccggttctctcttcgcccatgaaggacgaagggttcgatatatccgattac
cgttccattagaaagaatctcttccaggaaggtctggatgagctgaaacggagagaaatc
ttcgatgaatttatccgcaaggctgcggagcggggaatagccatcatattcgatgtggcg
gtgaatcatgtgagcagtcagcatgactggtttcaaaacgctctgaaagctgaggacaac
ccataccgcgattatttcatctggtccgaggataaccgggggtactcccaggcccggatt
atctttaaagggatgctggattcaaactggacgtattcccctgcagccgacaagtactac
tttcaccgcttttatccccatcagcccgacctgaattaccggaaccccagggtcctgtct
gaaattatccgggtgttcagctactggatccagcggggaatccgtgggttccggctggat
gctgcaccgtatctctggaaggaagagggaaccaactgcgaaaaccttgggaaaacccat
gatatcatcaaaattctccggaaaagcgttgagctgattcaggaggatgttcttctcctt
gcagaggcctgtcagcctcccagggaggtggtgagttatttcggtgataacgacgaatgt
caggccgcctatcattttcccctgatgccgagaatgtaccgttccattctccaggaatca
gccgaacccatcgtggatgtgatgaagccgggggtaacccccgccatatcccgggaaaac
cagtggttcaccttcctgcggcttcatgatgagctcacccttgagatggtgagtccggaa
gagcgggaatttctccacggaaagctctgcaagcgtccggagtgggatttccggaacggc
gaagggatttcagcccgtcttgctgagcttttcgacactcccagggaagtgctcttcgcc
catctgctcctgctggggatgagcggaaacccggtgatttattacggagatgaggttctt
gaggggaataatgttgagttcgcccggtatcagcaggagcataccggttttgtggacagc
aggaacctggtgcgggggcctctcaactggaaccggatcgacggacgcctggctgacggc
tccagcgatgaggcctggcattaccggaacatggcggctgcaatccattgccggctctcc
catccgcagatatccaatgcggctggggaagagcgcgaggtgattaatgatagccggggc
tcagccatcggcctgaagctgataaaagaagacggatttgaactgtactataacctgagt
caaagccgtgagctgagcattgagcttccggcttcccaccgtcccatactcagctggagc
ggattacgggaaaatgacctggaatctgaagtgaatccccatgaccctgaggccggaaca
gttccctcgggagatccgaaagaagcttcccggattcagcttccgccccggggggtattg
tgggtttctgtataa

DBGET integrated database retrieval system