KEGG   Sideroxydans lithotrophicus: Slit_0396Help
Entry
Slit_0396         CDS       T01196                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Slit_0396
Enzymes [BR:slt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Slit_0396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
401674..404049
Genome map
AA seq 791 aa AA seqDB search
MTKMIEQINSAGAPGSPGIAPTWCSSAKEIVGCSLGASRVWFTIGGGIINEVFYPRVDIP
QIRDLGFIVADDQGFWVEVKRMDSHKLVWAAQGVPALEVVHQHERFTLTLRIAPDRQRDV
LLIDVRLEGESGLRPYALLAPHLGGSGHDNQAEVGSYRNHRVLWAEQGPYGLALAAADGR
QRDAWFRAGAGYVGASDGWQDFSRHGRMEWQYPRAGPGNVSLMGELPRQATLALGFAGSR
ESAATLAISALKRPFEEPWQQLLGDWSAWHHRCVEQREFQHEIPDPLRDQFYTSAMVLRV
HQDKIHLGAMVASLSVPWGNTRDERGGYHLVWPRDLVESAGALLALGAEDEARDILRYLI
ATQHADGHWYQNQWLGGKPYWQGVQLDEVAFPVLLAARLAERGALQGIEVADMVKRAIGF
IARTGPISQQDRWEEDTGINAFTLSVCISALVAGAEWLDAEPREFVLDLADYWNAHVEDW
TVVYDTELARRIGVRGYYIRNAPTERDINPRALLDVLPIKNRSAETVLSAAEQVGIDFLQ
LVRFGLRQAHDPLIVDSLRVIDELLKVVTPSGPSWHRYNGDGYGEHNDGEPFDGVGQGRA
WPLLTGERGHYELAAGKDPLFYLEAMVAMSGNGGMIPEQVWDSDPIPAKGLYPGRPSGSA
MPLVWAHAEYIKLLISRQLGHPFDRPAAAWQRYHGVRPAIRHAIWSSQHQIRKIGSGQAL
FIMVYEPSIIHWSANGWQSAQDTPTRDTGLGLHFAELGTLAVHPGRIDFTIQRVDTGEWL
GHNCIVEIGSG
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagatgattgaacagataaacagtgcaggtgcgccgggcagtcccggcattgcg
ccgacctggtgcagcagcgccaaggaaatcgttgggtgttccctgggggcatctcgcgtg
tggttcaccatcggcggcgggatcatcaacgaagtcttctatccgcgcgtcgatatcccg
cagatccgtgatctcggcttcatcgttgccgacgaccagggtttctgggtagaagtgaag
cgcatggacagccataagctggtatgggcagcgcagggagttcccgcactggaggtggtt
catcaacatgaacgtttcacattaacacttcggatcgcacctgatcgtcaacgcgatgta
ttgctgatcgatgtcaggcttgagggtgagtcgggactgcggccttatgcgctgcttgca
ccgcacctcggcggcagtggtcatgacaatcaggctgaggtcggcagctatcgcaatcat
cgagtgctgtgggcagagcaagggccatacgggttggcccttgccgctgcagatggcagg
cagcgtgatgcctggtttcgtgccggcgcggggtatgtcggggcaagcgatgggtggcag
gatttttcccggcacggcaggatggaatggcaatatccgcgagccggtcccggcaacgtg
tctctgatgggtgagctgcccaggcaagcgacccttgccctgggtttcgcgggcagcagg
gaatcggcggccaccctggcgatctccgccctgaagcggccgttcgaggaaccttggcaa
cagctgcttggcgactggtcggcatggcaccaccgctgcgttgagcagcgcgaatttcaa
catgaaatcccggacccgttgcgcgaccagttctatacatctgccatggtattgcgagtc
catcaggacaagatccatctgggtgcgatggtcgccagccttagcgttccctgggggaat
acgcgcgacgaacgcggcgggtatcacctggtctggccccgtgatctggtggaaagtgca
ggggcattgttggcgctgggcgctgaagacgaagcgagggatatcctgcgttatcttatc
gcgacgcaacatgctgacggacactggtatcagaatcagtggctgggcgggaaaccatac
tggcaaggagtccagctcgatgaagtcgcgtttccggtcctgcttgcagcaaggctggcg
gagcgcggtgcattgcaaggcatagaagtcgccgacatggtcaagcgtgcaatcgggttc
atcgcccggaccggtccgatcagtcagcaggatcgctgggaagaagataccgggatcaat
gcgttcactctgtcggtatgtatctctgctttggtggcgggggcggaatggcttgatgct
gaaccgcgtgaattcgttctggatctcgcggattactggaacgcgcatgtcgaagactgg
accgtggtctatgacacggaactggcacgccgcatcggtgttcgtggctattacatccgc
aacgccccaacggaacgcgatatcaacccgcgtgcgctccttgatgtgttgccgatcaag
aacaggtcggccgaaacggtattgtccgccgcagagcaggtcggcatcgattttctgcaa
ctggtgcgcttcggcctgcgtcaggcacatgaccctttgatcgtcgacagtctccgcgtc
atcgatgagctgctgaaagtggtcacgccgagcggtccttcgtggcatcgctataacggc
gacggttatggcgaacataacgacggggagccgttcgatggtgtgggacaggggcgtgca
tggccgttgctgacaggcgagcgagggcactatgaactcgctgccgggaaagaccccttg
ttctatctggaagcaatggtcgccatgagcggcaacggcggcatgattccggaacaagtg
tgggacagcgatcccattccggccaaagggctctatcccgggcgtcccagcggttcagcc
atgcctttggtctgggcgcatgcggagtacatcaaactcctgatatccaggcaactcggt
catccgttcgaccggccggccgcagcttggcaacgctatcatggtgtgcgaccggcgatc
aggcatgcgatctggtcgtcgcaacatcagatccggaagatcggcagcggtcaggcattg
ttcatcatggtgtatgagccaagcatcattcattggagtgcaaatggatggcaatctgcg
caagacacgccgacccgggacaccggtcttgggcttcatttcgcggaactgggcacactg
gccgtgcatccggggcgcatcgacttcacgatccagcgtgtggatacaggtgaatggctg
ggccacaactgtattgtcgagataggaagcggttaa

DBGET integrated database retrieval system