KEGG   Sideroxydans lithotrophicus: Slit_0400Help
Entry
Slit_0400         CDS       T01196                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00230  Purine metabolism
slt01100  Metabolic pathways
Module
slt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Slit_0400
Enzymes [BR:slt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Slit_0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 MMR_HSR1 PAPS_reduct cobW AAA_22
Motif
Other DBs
NCBI-ProteinID: ADE10641
UniProt: D5CM27
Position
complement(407003..407614)
Genome map
AA seq 203 aa AA seqDB search
MSGNLFIVSAPSGAGKTSLVSALLKSNSHIDLSISYTTRAPRPGETDGKDYHFVSREIFL
EMAKRGDFLESAEVYGNLYGTSQPWIEKELASGRDILLEIDWQGAEQVRRLMPHAISIFI
LPPSLSALETRLHGRGQDSAEVIARRLQAAREDISHVAEFDYVIINDKLDEALRQLDAVI
ISVGLRRDSQLSRHAALINQLHK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaatcttttcatcgtcagcgcaccgtcgggagcaggcaagaccagcctggtc
agcgcgctgctcaaaagcaacagccacatcgacctttccatctcctacaccacgcgcgca
ccgcgccccggcgaaacggacggcaaggactaccatttcgtcagccgggagatcttcctg
gagatggcgaaacgcggggacttcctggaaagtgccgaggtctacggcaacctgtacggg
acctcgcagccatggatcgaaaaggagcttgcctcgggacgcgacatcctgctggagatc
gactggcagggcgctgagcaggtacgccggctgatgccgcacgccatctccatcttcatc
ctgccgccgtcgctgtctgcgctggaaacgcgcctgcacggccgcggccaggacagcgcc
gaggtgatcgcccgccgcctgcaggccgcgcgggaagacatctcgcatgtggccgagttc
gactatgttatcatcaacgacaagctggacgaggcattgcggcagctggacgcggtgatc
atctccgtaggtctgcgccgcgacagccaactctcacgtcacgcggcactcatcaaccaa
ttgcacaaatag

DBGET integrated database retrieval system