KEGG   Sideroxydans lithotrophicus: Slit_0449Help
Entry
Slit_0449         CDS       T01196                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
slt  Sideroxydans lithotrophicus
Brite
Enzymes [BR:slt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Slit_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(457123..457938)
Genome map
AA seq 271 aa AA seqDB search
MTPITLPGGEHAVLLLHGLQSSPAELLPLAKRLQQAGYTVHLPHIAGYGFEHGDTPRSVT
HWQDWHAKALEEFRALKRQYKSVAVGGLCIGGTLSLSIAAELGDQVAALTLLSTTLWYDG
WAMPWYRIFRYLGYIWPFRYRYTYKEREPFGLKNQQLRRWIAREMAHKDASMIGASRLNM
PAVQEAERLIAAAKKTMPRVTAPAIIIHAVEDEISSPRSALYTAKHIGSKTVETVMLHNC
YHMITVDNDREQVADETIRFFAGARAQSTAS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaatcacgctgcctggcggtgaacacgccgtgctgctgctccacggactgcaa
agcagtccggccgaacttctgccgctggccaaacgcctgcagcaggccggttacacggtg
catctgccgcacatcgccggttacggtttcgaacacggcgatacgccgcgttcggtcacc
cattggcaggattggcacgccaaggcactggaagagttccgcgcactcaaacggcagtac
aagagtgtcgccgtcgggggcttgtgcatcggcgggacgctatcgctcagcatcgccgcc
gaactgggcgaccaggtcgccgcactgacgctgctttccaccacactgtggtatgacggc
tgggccatgccctggtaccgcatcttccgttatctcggctatatctggcctttccgctat
cgctacacatataaggaaagggaaccgttcggcctgaagaaccagcaattgcgccgctgg
atcgcccgcgagatggcgcacaaggatgcctccatgatcggggccagtcgcctgaacatg
ccagccgtgcaggaagcggagcgcctgatcgccgcagcgaagaagacgatgccgcgcgtc
acggcccctgccatcatcatccatgccgtggaagacgagatatcctccccgcgcagcgcg
ctctataccgccaaacacatcggttcgaagaccgtggagaccgtgatgctgcataactgc
taccacatgatcaccgtggacaacgaccgcgaacaggtcgccgacgaaaccatccgtttc
ttcgctggcgcacgcgcccaaagcaccgccagctag

DBGET integrated database retrieval system