KEGG   Sideroxydans lithotrophicus: Slit_0526Help
Entry
Slit_0526         CDS       T01196                                 

Definition
(RefSeq) succinyl-CoA synthetase, subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slit_0526
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slit_0526
   00640 Propanoate metabolism
    Slit_0526
   00660 C5-Branched dibasic acid metabolism
    Slit_0526
Enzymes [BR:slt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Slit_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
530445..531614
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQGKEILREFSVPTPRGMACFNVEEAVAAAKQLGGNVWVVKAQIHAGGRGKGGGV
KVAKSLDEVRQFASQILGMHLVTHQTGPEGQVVHRLLIEEGARIAREFYVGMVVDRGSQR
VALLASSEGGMEIEEVAKHSPEKIHTVRIDPATGLNEAEAVRTARAIGIPDAAIAEAVKV
LWGLYQAFVEKDAMLAEINPLVLTADNRVLALDAKFNFDSNALYRHPEIVALRDLDEEDP
AEIEASKFDLSYIQLDGDIGCLVNGAGLAMATMDIIKLYGGSPANFLDVGGGASKEKVTE
AFKLMLKNPHLKAILVNIFGGIMKCDVIAEGVVAAAREVHLAVPLVVRLEGTNVELGKKI
LAESGLPIISGNDMADAAQKVVAAAKGAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccatgaataccaaggtaaagagatattgcgcgaattcagcgtgccgaccccg
cgcgggatggcgtgcttcaacgtcgaggaagcggttgctgcagcgaagcaattgggcggc
aacgtctgggtggtgaaggcgcagatccacgcgggggggcgcggcaagggtggcggagta
aaagtggccaagtcattggatgaggtgcgccagttcgcaagccagattctcggcatgcat
ctggtcactcatcaaaccggcccggaggggcaggtggtgcaccggttgctcatcgaggaa
ggcgcccggatcgccagggagttctatgtgggcatggtggtggaccgcggctcgcagcgc
gtcgccctgctggcttccagcgagggcggcatggagatcgaagaggttgccaaacattcg
ccggaaaagatacataccgtgcgtatcgacccggcgaccggactgaacgaagccgaggca
gtacgaacggcgcgcgcgatcggcatccccgatgcggcgattgccgaggcggtcaaggtg
ctctgggggttgtatcaggcctttgtcgaaaaggatgcgatgctggcagagatcaatccg
ctggtgctgactgcggataaccgcgtgctggcactggatgcgaaattcaacttcgattcc
aacgcgctgtaccgccatcccgagatcgtcgctctgcgcgacctggacgaggaagacccg
gcagagatcgaggcatcgaagttcgatctgagctacatccagctggacggggacatcggc
tgcctggtgaacggcgccggactggcgatggcgaccatggatatcatcaagttgtatggc
ggcagcccggcgaatttccttgatgtcggcggcggcgccagcaaggagaaagtcaccgag
gcgttcaagctgatgctgaagaatccgcacctcaaggcgatcctggtcaacatcttcggc
ggcatcatgaagtgcgatgtgatcgcggagggcgtggtggcggcagcgcgcgaggtgcat
cttgccgtgccgctggtggtgcggctggaggggaccaacgtggaactgggcaagaagatc
ctggcggaatccggcttgcccatcatttccggcaacgatatggcggatgcggcacagaag
gtagtggctgccgcaaagggggcgaaatga

DBGET integrated database retrieval system