KEGG   Sideroxydans lithotrophicus: Slit_0621Help
Entry
Slit_0621         CDS       T01196                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
slt  Sideroxydans lithotrophicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(632525..634186)
Genome map
AA seq 553 aa AA seqDB search
MSNPKAPSEIARETLTALAFRKLAPTPENYAQMYREISGEPAPAPSPDIGATTSKGKLVP
AWSELIRDLLRQLETPHKGITITRKKDGVETVLTRFSKDPEVLFGKLQSLLRSWSTAPAG
ASPDELVPSVKPGTTLPPTSSPATSAPSVPPVQAEHQELISQLRELLAQTLESMRSSQPE
LESEIQTLIAQVRASDNKDRLNDLAKQLRQFWLKLELRGGDKAKIQEGLVRLLRLLVENV
SEMVEDDKWLRGQITALQEIITNPLDKRSIADAERNLRDVIIKQGTLKQSLTDAKATLKS
LMTTFIDRLGDLTASTGEYHNKIEGYSQKIGKADNLTELSHILKDVMHDTRVIQASAMRS
HEELLSSKKQADEAETRIRELENELEQISELVREDQLTGALNRRGLDETLDRELKRSDRS
KTPVSVALLDIDNFKQLNDSLGHLAGDRALIHLTKVIKETLRPADTVGRYGGEEFLIVLP
DTGLKAAVEAMQRLQRDLTKKFFLHNNERILVTFSAGVALRGEDEEAEDLIGRADKAMYQ
AKQAGKNRVMTAG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccccaaggctccttcagagatcgcccgcgagacgctgaccgcgctcgccttt
cgcaagttggcaccaacgccggagaattacgcgcagatgtaccgcgagatcagcggcgaa
cccgccccggcgccttctcccgacatcggcgcgacgaccagcaaaggcaagctcgttccc
gcctggtcggaattgatccgggacttgctgcgccaattggagacaccacacaaaggcatc
accatcacccgcaagaaagacggtgtggagaccgttctgacacgattctccaaggatccg
gaagtgctgttcggtaaattgcagagcctgctgcgttcctggtccaccgccccggctgga
gccagcccggacgaactggtcccttccgtcaaacccggcacaacacttcctcccacctcc
tcgccagcaacctcagccccatccgtacccccggttcaggccgaacaccaggaactgatc
agtcagttgcgcgagctgctggcacagacgctggagagcatgcgctccagccagccggag
ctggaaagcgagatacagacactgatcgcacaggtccgcgcatccgacaacaaggatcgt
ctcaacgacctcgccaagcaactgcgccagttctggctcaagctggaactgcgcggcggc
gacaaggcgaagatacaggaaggtctggtgcgcctgttgcgcctgctggtagagaatgtc
agcgaaatggtggaagacgacaaatggctgcgcggtcagatcactgcgctgcaggagatc
atcaccaacccgctggacaagcgttccatcgccgacgccgagcgcaacttgcgcgatgtc
atcatcaaacagggtacgctcaagcaaagcctgaccgatgccaaggccaccctgaagagc
ctgatgaccacattcatcgaccgcctgggtgacctgaccgccagtaccggcgaataccac
aacaagatcgagggctacagccagaagatcggcaaggccgacaacctgaccgagctcagc
catatcctgaaggacgtgatgcacgacactcgcgtcatccaggccagcgccatgcgctcg
cacgaagaactgctttcctcaaagaaacaggccgacgaagccgaaacgcgcatcagggag
ctggagaatgaacttgagcagatcagcgaactggtacgcgaagaccagcttacgggcgcg
ctcaaccggcgcggcctggacgaaaccctggatcgcgagctgaagcgctcagaccgcagc
aaaacacctgtcagcgtcgccctgctcgacatcgacaacttcaagcaattgaacgactcc
ctcggacacctggctggcgaccgcgccctgatacacctgacaaaagtcattaaagaaacg
ctgcgccctgccgatacagtaggacgttacggcggtgaggagttcctcatcgtactgccc
gataccggcctgaaagctgccgtagaggccatgcagcgcctgcaacgcgacctgaccaag
aagttcttcctgcacaacaacgagcgcatcctggtcaccttcagcgccggcgtggcattg
cgcggagaggatgaagaggccgaagacctgatcggacgtgccgataaggcgatgtaccaa
gccaagcaggccggcaagaaccgtgtaatgaccgctggatag

DBGET integrated database retrieval system