KEGG   Sideroxydans lithotrophicus: Slit_0621Help
Entry
Slit_0621         CDS       T01196                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
slt  Sideroxydans lithotrophicus
Brite
Enzymes [BR:slt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Slit_0621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(632525..634186)
Genome map
AA seq 553 aa AA seqDB search
MSNPKAPSEIARETLTALAFRKLAPTPENYAQMYREISGEPAPAPSPDIGATTSKGKLVP
AWSELIRDLLRQLETPHKGITITRKKDGVETVLTRFSKDPEVLFGKLQSLLRSWSTAPAG
ASPDELVPSVKPGTTLPPTSSPATSAPSVPPVQAEHQELISQLRELLAQTLESMRSSQPE
LESEIQTLIAQVRASDNKDRLNDLAKQLRQFWLKLELRGGDKAKIQEGLVRLLRLLVENV
SEMVEDDKWLRGQITALQEIITNPLDKRSIADAERNLRDVIIKQGTLKQSLTDAKATLKS
LMTTFIDRLGDLTASTGEYHNKIEGYSQKIGKADNLTELSHILKDVMHDTRVIQASAMRS
HEELLSSKKQADEAETRIRELENELEQISELVREDQLTGALNRRGLDETLDRELKRSDRS
KTPVSVALLDIDNFKQLNDSLGHLAGDRALIHLTKVIKETLRPADTVGRYGGEEFLIVLP
DTGLKAAVEAMQRLQRDLTKKFFLHNNERILVTFSAGVALRGEDEEAEDLIGRADKAMYQ
AKQAGKNRVMTAG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccccaaggctccttcagagatcgcccgcgagacgctgaccgcgctcgccttt
cgcaagttggcaccaacgccggagaattacgcgcagatgtaccgcgagatcagcggcgaa
cccgccccggcgccttctcccgacatcggcgcgacgaccagcaaaggcaagctcgttccc
gcctggtcggaattgatccgggacttgctgcgccaattggagacaccacacaaaggcatc
accatcacccgcaagaaagacggtgtggagaccgttctgacacgattctccaaggatccg
gaagtgctgttcggtaaattgcagagcctgctgcgttcctggtccaccgccccggctgga
gccagcccggacgaactggtcccttccgtcaaacccggcacaacacttcctcccacctcc
tcgccagcaacctcagccccatccgtacccccggttcaggccgaacaccaggaactgatc
agtcagttgcgcgagctgctggcacagacgctggagagcatgcgctccagccagccggag
ctggaaagcgagatacagacactgatcgcacaggtccgcgcatccgacaacaaggatcgt
ctcaacgacctcgccaagcaactgcgccagttctggctcaagctggaactgcgcggcggc
gacaaggcgaagatacaggaaggtctggtgcgcctgttgcgcctgctggtagagaatgtc
agcgaaatggtggaagacgacaaatggctgcgcggtcagatcactgcgctgcaggagatc
atcaccaacccgctggacaagcgttccatcgccgacgccgagcgcaacttgcgcgatgtc
atcatcaaacagggtacgctcaagcaaagcctgaccgatgccaaggccaccctgaagagc
ctgatgaccacattcatcgaccgcctgggtgacctgaccgccagtaccggcgaataccac
aacaagatcgagggctacagccagaagatcggcaaggccgacaacctgaccgagctcagc
catatcctgaaggacgtgatgcacgacactcgcgtcatccaggccagcgccatgcgctcg
cacgaagaactgctttcctcaaagaaacaggccgacgaagccgaaacgcgcatcagggag
ctggagaatgaacttgagcagatcagcgaactggtacgcgaagaccagcttacgggcgcg
ctcaaccggcgcggcctggacgaaaccctggatcgcgagctgaagcgctcagaccgcagc
aaaacacctgtcagcgtcgccctgctcgacatcgacaacttcaagcaattgaacgactcc
ctcggacacctggctggcgaccgcgccctgatacacctgacaaaagtcattaaagaaacg
ctgcgccctgccgatacagtaggacgttacggcggtgaggagttcctcatcgtactgccc
gataccggcctgaaagctgccgtagaggccatgcagcgcctgcaacgcgacctgaccaag
aagttcttcctgcacaacaacgagcgcatcctggtcaccttcagcgccggcgtggcattg
cgcggagaggatgaagaggccgaagacctgatcggacgtgccgataaggcgatgtaccaa
gccaagcaggccggcaagaaccgtgtaatgaccgctggatag

DBGET integrated database retrieval system