KEGG   Sideroxydans lithotrophicus: Slit_1057Help
Entry
Slit_1057         CDS       T01196                                 

Definition
carbamoyl-phosphate synthase, large subunit
Orthology
K01955  
carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:slt00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:slt00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1032433..1035651
Genome map
AA seq 1072 aa AA seqDB search
MPKRTDIKSILIIGAGPIVIGQACEFDYSGAQACKALREEGYRVILVNSNPATIMTDPNM
ADATYIEPITWQMVEKIIAKEKPDAILPTMGGQTALNCALDLAKHGVLEKYNVEMIGASR
DAIDMAEDREKFKQAMTRIGLASARSAIAHSMEEALQVQQVMGFPTIIRPSFTMGGSGGG
IAYNREEFVEICERGLEASPTRELLIEESLLGWKEYEMEVVRDRNDNCIIICSIENLDPM
GVHTGDSITVAPAQTLTDKEYQIMRDASLAVLREIGVETGGSNVQFSINPDDGRMVVIEM
NPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELKNDITGGATPASFEPTIDYVVTKIP
RFAFEKFPQANDRLTTQMKSVGEVMAIGRTFQESFQKALRGLEVGVNGLDTKYTEREAIV
SEMGNPGPDRIWAVGDAFRLGMSVEEVFSVSKIDPWFLVQIADLIRQEQALAGRTLESLS
ADHLRTLKRSGFADARLAKLLGIDDESVRAYRHALGVRPVFKRVDTCAAEFATNTAYMYS
TYEEECESLPTSNKKIMVLGGGPNRIGQGIEFDYCCVHAALAMREDGYETIMLNCNPETV
STDYDTSDRLYFEPLTLEDVLEVVAVEKPIGVIVQYGGQTPLKLAHGLAKNGVPIIGTTP
DMIDMAEDRARFQAMLRELNLKQPPNRTASNVADGVAGAAEIGYPLVMRPSNVLGGRAME
IIHAQSDLERYMRDAEEMSKTYPERMPILLDRFLNDAIEVDVDAVSDGKQVIIGGIMEHI
EQAGVHSGDSACSLPPYSLSAKLQDELRRQTVAMAKSLNVVGLMNVQFAIQGETVYVLEV
NPRASRTVPYVSKATSVPLAKIAARCMAGQTLAQQGVTKEVIPPYYSVKEAVFPFIKFPG
VDTILGPEMKSTGEVMGVGDSFAEAFVKSQLAASVKLPKSGKVFISVREEDKHGAAEVAR
TLKQLGFTILATRGTGSVITAAGVEVTVVNKVAEGRPHIVDMIKNGDISLIVNTVDSKPS
VMRDSYSIRHAALQGRVTYYTTLAGARAACLGMQHLAELQVYDLQSLHRRME
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagcgtacagacatcaagagcatcctcattatcggcgccggccccatcgtcatc
ggccaggcgtgcgagttcgattattccggtgcgcaggcttgcaaggcgctgcgcgaagaa
ggctaccgcgtcatcctggtgaactcgaatccggccaccatcatgaccgacccgaacatg
gcggatgcgacctacatcgagccgatcacctggcagatggtggagaagatcattgccaag
gagaagcccgacgcgatcctgccgaccatgggcgggcagaccgcgctgaactgcgcgctc
gacttggccaagcacggcgtactggaaaagtacaacgtcgagatgatcggcgcctcgcgc
gacgccatcgacatggcggaagaccgcgagaaattcaagcaggctatgacgcgcatcggg
ctggcttcggcacgctccgccatcgcgcacagcatggaagaagcgctgcaggtgcagcag
gtgatgggttttcccaccatcatccgcccgtcgttcaccatgggcggcagcggcggcggc
atcgcctacaaccgcgaagaattcgtggagatctgtgagcgcggcctggaagcgtcgccc
acgcgcgagctgctgatcgaggaatcgctgctcggctggaaagaatacgagatggaagtc
gtgcgcgaccgcaacgacaattgcatcatcatctgttccatcgagaacctcgacccgatg
ggcgtgcataccggcgattccatcaccgtcgcgccggcgcagacgctgaccgacaaggaa
taccagatcatgcgcgacgcctcgctggcagtgctgcgcgagatcggcgtggagaccggc
ggttccaacgtgcagttctccatcaacccggacgacgggcgcatggtggtgatcgagatg
aacccgcgcgtgtcgcgttcctcggcgctggcgtccaaggccacgggttttcccatcgcc
aaggtcgcggccaaactagccgtcggctatacgctggacgaactcaagaacgacatcacc
ggcggtgccaccccggcctcgttcgaaccgaccatcgattacgtggtcaccaagataccg
cgcttcgccttcgagaaattcccgcaagccaacgaccgcctgaccacacagatgaaatcg
gtgggcgaggtgatggccatcggccgcaccttccaggagtcgttccagaaagccttgcgc
ggcctggaagtcggcgtcaatggcctggatacaaaatacactgagcgcgaagccatcgtt
tccgaaatgggcaatcccgggccggatcgtatttgggcagtgggcgatgccttccgcctc
ggtatgagcgtggaagaggtgttcagtgtcagcaagatcgacccgtggttcctggtgcag
atcgccgacctgatccgtcaggagcaggcactggccggccgcaccctggaaagcctgagc
gcggatcatctgcgtaccttgaagcgcagcggttttgccgatgcgcgtctggcaaaattg
ctgggcatcgatgatgagtcggtgcgcgcctaccgccatgcgctgggcgtgcgtccggtg
ttcaaacgtgtggacacctgtgccgccgagttcgccaccaacaccgcctacatgtattcg
acctacgaggaagaatgcgaatcgctgcctaccagcaacaagaagatcatggtgctgggc
ggcgggccgaaccgtatcggccagggaatcgagttcgactattgctgcgtgcatgccgcg
ctggcgatgcgtgaggatggctatgagaccatcatgctcaactgcaatcccgagaccgtt
tccacagattacgacacctccgatcgtttgtatttcgagccgctgacactggaagacgtg
ctggaagtggtggcggtggagaaacccatcggcgtgatcgtgcaatacggcggacagacg
ccgctgaagctggcgcacggtctggcgaagaacggcgtgcctatcatcggcaccacgccg
gacatgatagatatggcagaagaccgcgcgcgcttccaggccatgctgcgcgaactgaac
ctgaagcagccgcccaaccgcacggccagcaatgtggcagacggcgtggcgggtgcagcc
gagatcggctatccgctggtgatgcgtccttccaacgtgctgggcggccgcgccatggag
atcatccatgcgcaatcagatcttgagcgctacatgcgcgatgccgaggaaatgtccaag
acttatcccgaacgcatgcccatcctgctcgaccgtttcctgaacgatgcgatcgaagtg
gacgtggatgcggtgtccgacggcaagcaggtcatcatcggcggcatcatggagcacatc
gaacaggcgggtgtgcactccggcgactcggcatgttcgctgccgccgtattcgctgtcc
gccaagttgcaggacgagttgcgccgccagaccgtggcgatggccaagtcgctcaatgtg
gtcggcctgatgaacgtgcagttcgccatccagggtgagacggtatacgtgctggaagtg
aatccccgtgcttcgcgcacggtgccctatgtgtccaaagcgaccagcgtgccgctggcc
aagatcgctgcgcgctgcatggcaggccagacattggcgcagcagggtgtgaccaaagag
gtcatcccgccttattattcggtgaaagaggcggtgttccctttcatcaagttccccggc
gtcgataccatccttggtccggaaatgaaatccaccggcgaagtgatgggtgtgggcgat
agcttcgcggaagccttcgtcaaatcgcagcttgctgccagcgtgaagctgccgaagagc
ggcaaggtgttcatcagcgtgcgcgaggaggacaagcatggtgctgccgaagttgcgcgc
accttgaagcagttgggcttcaccatcctggcgacccgtggcacaggctcggtcatcact
gctgcgggagtggaagtgactgtggtgaacaaggtcgccgaaggccgcccccacatcgtg
gacatgatcaagaacggcgatatcagccttattgtcaacacagtggatagcaagccgtcg
gtgatgcgggattcgtattcgatccgccatgcagcgttgcagggcagggtgacgtactac
actacgcttgccggtgcacgtgccgcctgtcttggtatgcagcatctggcggaattgcag
gtctatgacttgcagtctttgcatcgccgcatggaataa

DBGET integrated database retrieval system