KEGG   Sideroxydans lithotrophicus: Slit_1068Help
Entry
Slit_1068         CDS       T01196                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slit_1068
   01230 Biosynthesis of amino acids
    Slit_1068
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slit_1068
   00051 Fructose and mannose metabolism
    Slit_1068
   00562 Inositol phosphate metabolism
    Slit_1068
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Slit_1068
Enzymes [BR:slt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Slit_1068
Exosome [BR:slt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Slit_1068
  Exosomal proteins of bladder cancer cells
   Slit_1068
  Exosomal proteins of melanoma cells
   Slit_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1046209..1046961
Genome map
AA seq 250 aa AA seqDB search
MRRKMVVGNWKMHGSLVQNESLLSALKSGAAQLSHVDIAVCAPFPYLAQLQQQLSASSVK
WGAQDVHQLEKGAFTGEVSAAMLADFGCTYVIVGHSERRSIYGEDSRLVAEKFSAAQQAG
LIPILCVGETLQQRESGETEAVVAEQLDAVIALVGVQALRKAVVAYEPVWAIGTGKTASP
DQAQSVHAFIRQRVAGHDEQVAQGLVILYGGSVKAANAPELFAKADIDGGLIGGAALVAE
EFLGICRAGQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtaaaatggtggtcggaaattggaaaatgcacggctcgctggttcagaatgag
tcgttgttgtccgccctgaagagtggtgccgcgcaactatcccatgtggatattgccgtc
tgtgcgccattcccttacttggcgcaactccaacagcaattatcggcttcgtcagtgaag
tggggcgcgcaggacgtgcaccagctcgaaaagggcgctttcactggcgaggtgtccgcg
gccatgctggcggattttggatgtacttatgtgattgtcgggcattccgagcgtcgcagc
atctacggcgaggacagccggctggtggcggaaaagttctctgcggcccagcaggcgggg
ttgataccgatcctgtgtgtgggggaaactttgcagcagcgcgaaagcggcgagactgag
gcggtggtggctgaacagctggatgctgtgatcgccttggttggagttcaggcattgcgc
aaggcagttgtggcgtacgagccggtctgggcgatcggtaccggcaagaccgcgtcgccg
gatcaggcgcagtcggtgcatgcctttattcgccagcgagtggccggccatgacgaacag
gtcgcacaaggcctggttatactgtatgggggcagcgtaaaggcggcgaatgcgccggag
ctgtttgccaaggcggatatcgatggcggcttgatcggtggtgctgctttggtggccgag
gagtttttggggatatgtcgcgctggccagtaa

DBGET integrated database retrieval system