KEGG   Sideroxydans lithotrophicus: Slit_1203Help
Entry
Slit_1203         CDS       T01196                                 

Definition
transaldolase (EC:2.2.1.2)
Orthology
K00616  
transaldolase [EC:2.2.1.2]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:slt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:slt01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:slt00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1197192..1198145)
Genome map
AA seq 317 aa AA seqDB search
MSNLLEQLKSMTAIVADTGDIEAIRAHQPEDATTNPSLLLKAASLPEYAPLIADALTWAK
SQGKDREQQAHDAIDKLAVNVGLEVLKIVPGRISTEVDARLSFNTQAMLAKARKLIRLYN
EAGVRNEQVLIKVASTWEGIRAGEILEHEGIHCNLTLMFGFAQARASAEAGVTLISPFVG
RIFDWQKAKEGRTDIPAEEDMGVLSVRKIYQYYKEHGYPTTVMGASFRNSGEILALAGCD
RLTISPALLQELQGAQGALPRRLHYAGAIKPRPASMTEAEFRWEMNEDAMATEKLAEGIR
GFTADQIKLEKALSDKL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatctgcttgaacaactgaaatccatgaccgcaatcgtcgccgacaccggcgat
atcgaggcaatacgcgcccatcagccggaagacgcgaccaccaacccttccttgctgctg
aaggcggcaagcttgcccgaatatgccccgttgatcgccgatgcactgacgtgggcgaag
tcgcaaggcaaggaccgggaacaacaggcacacgacgcgatagataaactggcggtgaac
gtcgggctggaagtgctgaagatcgtgccggggcgcatctcgaccgaagtggatgcgcgg
ctgtcgttcaatacacaggccatgctggcaaaggcacgcaagctgatacggctctacaac
gaggcaggcgtccgcaatgagcaggtattgatcaaggtcgcttcgacatgggaaggcata
cgcgccggcgagatcctcgagcacgaaggcatccattgcaatctcaccctgatgttcggt
ttcgcccaggctcgcgccagtgccgaggcgggcgtgacgctgatctcgccttttgtcggg
cgtatcttcgattggcaaaaagccaaggaggggcgcaccgacattcctgcggaagaagat
atgggggtgctttcggtgcgcaagatctaccagtactacaaggagcacggctacccgacc
acggtgatgggcgcatcgtttcgcaatagcggcgagatactggcgctggccggctgcgac
cgcctgaccatcagtccggcgctgctgcaggagctgcaaggcgcccagggcgcgctgcca
cgccgcctgcattacgcaggcgcgatcaagccgcgccctgcctcgatgaccgaggccgag
ttccgctgggagatgaacgaggatgcgatggcgacggagaagctggccgaagggatacgc
gggttcactgcggaccagatcaagctggaaaaagcgttgtcggataagttgtga

DBGET integrated database retrieval system