KEGG   Sideroxydans lithotrophicus: Slit_1267Help
Entry
Slit_1267         CDS       T01196                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:slt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Slit_1267
DNA repair and recombination proteins [BR:slt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Slit_1267
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Slit_1267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim Baculo_LEF5_C HHH HHH_5
Motif
Other DBs
NCBI-ProteinID: ADE11504
UniProt: D5CRB8
Position
1257114..1257713
Genome map
AA seq 199 aa AA seqDB search
MNTPSSLEELIKALRCLPGVGPKSAQRMAYHLLQRDRQGALHLARSLDQAVSSVRHCSKC
NNFSEEDVCPMCRSQRRETDMLCVVEMPADLLMMEQAQCYRGMYFVLMGRLSPLDGLGAK
DLPLERLLKRARELSCEVILATNFTIEGEATAHYLATLLRAQGLKVSRIARGLPVGGELE
HVDSGTLAQAVLERRTVTE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaatactccttccagtctggaagagctgatcaaggctttgcgctgtttgccgggtgtg
ggtcccaagtcggcgcaacgcatggcttaccacctgctgcagcgcgacaggcaaggtgcc
ttgcatcttgcgcgttcgcttgatcaggcagtaagcagtgtcaggcactgcagcaagtgc
aataatttttctgaggaagacgtctgtcccatgtgccgttcgcagcgacgcgagacggac
atgctgtgcgtggtagaaatgcctgccgatctgttgatgatggagcaggcgcaatgctac
cgcggaatgtattttgtattgatggggcgcctttctcccctggatggcctgggggcgaag
gatctgccgctggagcgcttgctgaaacgtgcacgggagctgtcgtgcgaggtgatcctg
gcgacgaatttcaccatcgaaggcgaggcgacggcacactatttggcaaccttgctgcga
gcgcaggggctaaaggtgtcgcgcatcgcccgtggtttgccggttggcggcgaattggag
catgtggatagcggcactttggcgcaagccgtgctggaaagaaggacggtgacagaatga

DBGET integrated database retrieval system