KEGG   Sideroxydans lithotrophicus: Slit_1267Help
Entry
Slit_1267         CDS       T01196                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
slt  Sideroxydans lithotrophicus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:slt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1257114..1257713
Genome map
AA seq 199 aa AA seqDB search
MNTPSSLEELIKALRCLPGVGPKSAQRMAYHLLQRDRQGALHLARSLDQAVSSVRHCSKC
NNFSEEDVCPMCRSQRRETDMLCVVEMPADLLMMEQAQCYRGMYFVLMGRLSPLDGLGAK
DLPLERLLKRARELSCEVILATNFTIEGEATAHYLATLLRAQGLKVSRIARGLPVGGELE
HVDSGTLAQAVLERRTVTE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaatactccttccagtctggaagagctgatcaaggctttgcgctgtttgccgggtgtg
ggtcccaagtcggcgcaacgcatggcttaccacctgctgcagcgcgacaggcaaggtgcc
ttgcatcttgcgcgttcgcttgatcaggcagtaagcagtgtcaggcactgcagcaagtgc
aataatttttctgaggaagacgtctgtcccatgtgccgttcgcagcgacgcgagacggac
atgctgtgcgtggtagaaatgcctgccgatctgttgatgatggagcaggcgcaatgctac
cgcggaatgtattttgtattgatggggcgcctttctcccctggatggcctgggggcgaag
gatctgccgctggagcgcttgctgaaacgtgcacgggagctgtcgtgcgaggtgatcctg
gcgacgaatttcaccatcgaaggcgaggcgacggcacactatttggcaaccttgctgcga
gcgcaggggctaaaggtgtcgcgcatcgcccgtggtttgccggttggcggcgaattggag
catgtggatagcggcactttggcgcaagccgtgctggaaagaaggacggtgacagaatga

DBGET integrated database retrieval system