KEGG   Sideroxydans lithotrophicus: Slit_1287Help
Entry
Slit_1287         CDS       T01196                                 

Definition
glycoside hydrolase family 3 domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
slt  Sideroxydans lithotrophicus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:slt00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:slt00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1274217..1275266
Genome map
AA seq 349 aa AA seqDB search
MGNGPVMLDILGKTLTAEDERRLLHPLVGGVILFARNYESPSQLAELTASIHALRTPPLL
IAVDHEGGRVQRFREGFTRIPPMRELGKVWDDHPKRARHLAQQAGFVLASELRACGVDFS
FTPVLDVDYGASGVIGDRAFHSDPQAIAELAHSLLLGLRQGGMPTVGKHFPGHGFVKADS
HLEIPVDDRSYTDIELCDLIPFRQMVNYGLTAVMPAHVIYPKVDSRPAGFSSVWLKNVLR
GEMGFEGCIFSDDLSMEGATVAGGIVQRAEAALNAGADMVLVCNKPESADELLAGLKWDM
PAQSKARLAQMHGRPHSRTLVQLHEDADFIKALHEVAGIGMREGELPLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgggcctgtgatgctggatattctcggtaagacgcttactgcagaagacgag
aggcgcttgctccatccgctggtcggtggtgtcatcctgtttgctcgtaactacgaatct
cccagccagcttgccgagttgacggccagcatccatgcactgcgcacgccgccgctgctt
attgcggtggatcacgaaggcggcagggtgcagcgtttccgcgaaggttttacacgcatc
ccgccgatgcgcgagttgggcaaggtttgggacgatcatcccaaacgcgccaggcatctg
gcgcagcaagcaggttttgtgctggcttccgaactgcgagcctgcggcgtggacttcagt
tttactcctgtgctggatgtggattatggcgcaagcggagtgatcggcgaccgcgcattc
cattctgaccctcaagccatcgccgagctggcacacagtttactgctgggactcaggcag
gggggcatgccaacggtgggcaaacatttccctggtcatggattcgtcaaggcggattcg
catttggagataccggtggacgaccgcagttataccgacatcgaattgtgtgacctcatt
ccattccgccagatggtgaactacggtctcactgccgtgatgccagcccatgtcatttat
cccaaggtcgattcgcgtcctgctggtttctccagcgtgtggctgaaaaatgtcctgcgg
ggtgaaatgggctttgaaggatgcatcttcagcgacgacttgagcatggaaggagctacg
gtggccggtgggatcgtccagcgtgcggaagcggcattgaatgctggggcagacatggtg
ctggtatgcaacaaacctgagtccgccgatgaattattggcaggactgaagtgggacatg
ccggcacaaagcaaagcgcgtcttgcacagatgcacgggcgtccgcactcgcggacactg
gtgcagctgcatgaagatgccgatttcatcaaagcactgcatgaagtggccggcatcggc
atgcgcgaaggtgaactgcccttggtatag

DBGET integrated database retrieval system