KEGG   Sideroxydans lithotrophicus: Slit_1287Help
Entry
Slit_1287         CDS       T01196                                 

Definition
glycoside hydrolase family 3 domain protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
slt  Sideroxydans lithotrophicus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Slit_1287
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Slit_1287
Enzymes [BR:slt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Slit_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1274217..1275266
Genome map
AA seq 349 aa AA seqDB search
MGNGPVMLDILGKTLTAEDERRLLHPLVGGVILFARNYESPSQLAELTASIHALRTPPLL
IAVDHEGGRVQRFREGFTRIPPMRELGKVWDDHPKRARHLAQQAGFVLASELRACGVDFS
FTPVLDVDYGASGVIGDRAFHSDPQAIAELAHSLLLGLRQGGMPTVGKHFPGHGFVKADS
HLEIPVDDRSYTDIELCDLIPFRQMVNYGLTAVMPAHVIYPKVDSRPAGFSSVWLKNVLR
GEMGFEGCIFSDDLSMEGATVAGGIVQRAEAALNAGADMVLVCNKPESADELLAGLKWDM
PAQSKARLAQMHGRPHSRTLVQLHEDADFIKALHEVAGIGMREGELPLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatgggcctgtgatgctggatattctcggtaagacgcttactgcagaagacgag
aggcgcttgctccatccgctggtcggtggtgtcatcctgtttgctcgtaactacgaatct
cccagccagcttgccgagttgacggccagcatccatgcactgcgcacgccgccgctgctt
attgcggtggatcacgaaggcggcagggtgcagcgtttccgcgaaggttttacacgcatc
ccgccgatgcgcgagttgggcaaggtttgggacgatcatcccaaacgcgccaggcatctg
gcgcagcaagcaggttttgtgctggcttccgaactgcgagcctgcggcgtggacttcagt
tttactcctgtgctggatgtggattatggcgcaagcggagtgatcggcgaccgcgcattc
cattctgaccctcaagccatcgccgagctggcacacagtttactgctgggactcaggcag
gggggcatgccaacggtgggcaaacatttccctggtcatggattcgtcaaggcggattcg
catttggagataccggtggacgaccgcagttataccgacatcgaattgtgtgacctcatt
ccattccgccagatggtgaactacggtctcactgccgtgatgccagcccatgtcatttat
cccaaggtcgattcgcgtcctgctggtttctccagcgtgtggctgaaaaatgtcctgcgg
ggtgaaatgggctttgaaggatgcatcttcagcgacgacttgagcatggaaggagctacg
gtggccggtgggatcgtccagcgtgcggaagcggcattgaatgctggggcagacatggtg
ctggtatgcaacaaacctgagtccgccgatgaattattggcaggactgaagtgggacatg
ccggcacaaagcaaagcgcgtcttgcacagatgcacgggcgtccgcactcgcggacactg
gtgcagctgcatgaagatgccgatttcatcaaagcactgcatgaagtggccggcatcggc
atgcgcgaaggtgaactgcccttggtatag

DBGET integrated database retrieval system