KEGG   Sideroxydans lithotrophicus: Slit_1293Help
Entry
Slit_1293         CDS       T01196                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Slit_1293
   00052 Galactose metabolism
    Slit_1293
   00500 Starch and sucrose metabolism
    Slit_1293
   00520 Amino sugar and nucleotide sugar metabolism
    Slit_1293
Enzymes [BR:slt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Slit_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1283325..1284194
Genome map
AA seq 289 aa AA seqDB search
MKQKITKAVFPVAGMGSRFLPATKATAKEMLPIVDKPLIQYAVEEAVAAGITDMVFITGR
HKRAIEDHFDKAYELEATLEADGKLKLLSVIQDVVPKHVNCIYIRQAEPLGLGHAVLCAK
PVIQDEPFAVILADDLIDGEPPIIQQMVNVFAKYQCSILGVQDVPRANTKQYGIVSSVNL
EKDIERVSGIVEKPKPEVAPSTLAVVGRYILTPRIFHYLENIQPGAGGEIQLTDGIAELL
KEEQLLAYRFSGTRYDCGSKLGYLQAQVAYGLKHEELREDFAAYLKTVA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaatcaccaaagcagtgttccccgtggccggtatgggtagccggttcttg
cccgccaccaaagcaactgccaaggagatgctgcccatcgtcgacaagccattgatacag
tatgcggtggaagaggctgtagccgcgggtatcaccgatatggtgttcatcaccgggcgg
cacaaacgcgccatcgaagaccatttcgacaaagcctatgaacttgaggccacgcttgag
gctgatggcaaactcaagttgctgagcgtcatacaggatgtcgttcccaagcatgtgaac
tgcatctatatccgccaggctgagccgttgggtctggggcatgcggtactgtgcgccaag
ccggtcatacaggacgagccgtttgcagtgatcctggccgatgacctgatcgacggtgaa
ccgcccatcatccagcaaatggtgaacgtatttgccaaataccagtgttcgatcctgggg
gtgcaggatgtgccgcgtgccaacaccaagcaatacggtatcgtcagcagtgtcaatctg
gaaaaagacattgaacgggtaagcggcattgtggaaaagcccaagccagaagtcgctccg
tcgacattggcagtcgttgggcgttacatccttacgccgcgcatcttccattatctggaa
aatatccagcctggtgcgggaggggagatccagctcactgatggtatcgccgaactgctt
aaggaagagcagttgttggcctaccgctttagtggtactcgctacgactgtggttcaaaa
ctcggatatttgcaggcgcaagtcgcatacggcttgaagcatgaagagctgcgcgaggac
tttgctgcttatctgaaaacggtagcgtga

DBGET integrated database retrieval system