KEGG   Sideroxydans lithotrophicus: Slit_1358Help
Entry
Slit_1358         CDS       T01196                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slit_1358
   01230 Biosynthesis of amino acids
    Slit_1358
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slit_1358
   00030 Pentose phosphate pathway
    Slit_1358
   00051 Fructose and mannose metabolism
    Slit_1358
   00052 Galactose metabolism
    Slit_1358
  Energy metabolism
   00680 Methane metabolism
    Slit_1358
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Slit_1358
Enzymes [BR:slt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Slit_1358
Protein phosphatases and associated proteins [BR:slt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Slit_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1349881..1351134)
Genome map
AA seq 417 aa AA seqDB search
MAKKNAFYAQSGGVTAVINASACGVIETARNHKDKIGKVYAGRNGIIGALTEDLIDTTKE
SAKAIAALRTTPSGAFGSCRFKLKSLEQNKREYERLIEVFKAHNIGYFFYNGGGDSADTC
YKVSQLSETMGYPVQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTLEASFDVRSMAKT
STKVFVLEVMGRHAGWIAAAGGLAEEQGIPVVILFPEIEFDQKKFLAKVSAMVEKHGYCS
VVVSEGCHYPDGKFLAEQGTRDAFGHAQLGGAAPVVANMVKEALGHKFHWAVADYLQRAA
RHIASKTDVEQAYALGKSAVELALKGQNAVMPTVERISDKPYKWKVGVAPLSKVANVEKF
MPRNFITPDGFGITEKCRAYLTPLIKGEDYPPYKDGLPQYVQLKNIAVAKKLAEFKI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagaacgcgttctatgcacaatccggcggcgtcacagccgtcatcaatgct
tcagcctgcggcgtcatcgagaccgcccgcaatcacaaagacaagatcggcaaggtatac
gcggggcgcaacggcatcatcggcgccctcaccgaagacctgatcgacaccaccaaagaa
tccgccaaagccatcgctgcgctgcgcaccacaccttccggtgcattcggatcctgccgc
ttcaagctcaaatcactggaacagaacaagcgcgaatacgagcgcctgatcgaagtattc
aaggcacacaacatcggctatttcttctacaacggcggcggcgattcggccgacacctgt
tacaaggtatcgcaattgtccgaaaccatgggttatccggtgcaggccatccatgtaccc
aagaccgttgacaacgatctgccgatcaccgattgctgccccggtttcggttctgtcgcc
aagtacatcgccgtttccacgctggaggccagcttcgatgtacgctctatggccaagact
tcgaccaaggtgttcgtgctggaggtgatgggccgccatgccggctggatcgccgcagcc
ggggggctcgccgaagagcaaggaattccggtggtcatcctgttcccggagatcgaattc
gaccagaagaagttcctcgccaaggtcagtgcgatggtggagaagcacggctattgcagc
gtggtggtgtcggaaggctgccattacccggatggcaagttcctcgccgaacagggcacg
cgcgatgccttcgggcacgcccaactcggtggggctgcccccgtggtcgccaatatggtc
aaggaggcgctggggcataagttccattgggctgtagccgattatctgcaacgcgccgca
cgccacatcgcctccaagaccgacgtcgaacaggcttatgcgctgggcaaatccgcagtc
gagctggcactcaaaggccagaatgccgtgatgccgacggtggagcgcatttcagacaag
ccatacaaatggaaggtcggcgtcgctccgctgtcgaaagtcgccaacgtcgaaaaattc
atgccgcgcaatttcattacacctgacggcttcggcatcaccgaaaaatgccgcgcctat
ctcacgccactcatcaagggcgaggattacccgccatacaaggacggattgccacaatat
gtgcaattgaaaaatatagccgtcgcaaagaaattggcagagttcaagatttaa

DBGET integrated database retrieval system