KEGG   Sideroxydans lithotrophicus: Slit_1704Help
Entry
Slit_1704         CDS       T01196                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
slt  Sideroxydans lithotrophicus
Brite
Enzymes [BR:slt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Slit_1704
Secretion system [BR:slt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Slit_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1716306..1717019)
Genome map
AA seq 237 aa AA seqDB search
MNAFSYLVLLLFFFSNAALADEAAIKAAMEKRFPYEQVISVHKTPYLGLYEVVLNDQLVY
TDENMSYLFSGNIIDMHTMQNLTEEREKQLYAIDFDSLPLDLAIKNVKGNGKRRLAVFTD
PNCPYCRRQEKEMVGLTDATIYTFVLPILPGSKEKAEAIWCSSDRLKAWEDHMLKWKDPK
PGKTCDTSALTRIAAAAKKLNIVVTPTLVFEDGIMNPGWLRLELLDERLTSSSPKKK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcattctcttatttggtattgctgttgtttttcttttccaatgcggctttggcc
gatgaggccgctatcaaggccgcgatggaaaagagatttccctatgagcaggtcatcagt
gtccacaagactccctatctcggcttgtatgaagtggtcttgaacgaccaactggtctat
accgacgaaaatatgtcctaccttttttcaggcaacatcatcgatatgcatacgatgcag
aacctgactgaagaaagggaaaaacaactttatgcgatcgatttcgattccttgccgctt
gatctggcgatcaagaatgtgaaaggcaacggcaagagaagactggctgttttcaccgat
ccgaactgtccctattgcaggaggcaggaaaaggagatggtcggcctgaccgatgccacg
atctacactttcgtgttgccgatattgcccggttccaaggagaaggccgaggcgatctgg
tgctcatccgaccggctgaaagcctgggaggatcatatgctgaagtggaaggacccgaaa
ccgggaaagacctgtgatacctctgccttgacccgcattgccgcggcggcgaagaagctg
aatatcgtcgtgacgcccaccctggtgttcgaggacgggatcatgaatcccggctggctg
aggctggagctgctcgacgaacgtctcacctcgtccagcccgaagaaaaaatga

DBGET integrated database retrieval system