KEGG   Sideroxydans lithotrophicus: Slit_1751Help
Entry
Slit_1751         CDS       T01196                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Slit_1751
Enzymes [BR:slt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Slit_1751
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Slit_1751
Lipid biosynthesis proteins [BR:slt01004]
 Fatty acid synthase
  Component type
   Slit_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1759144..1759752
Genome map
AA seq 202 aa AA seqDB search
MKTFLKIALLIAALALSCSAQAAKNILLFGDSLSAGYGIERDDSWANLLQQELKKSHPQY
EVVNASISGETTAGGLRRIGKALQQHRPAVVVVELGANDGLRGGAIPEMKKNLDRIITQA
QKANARVLLLGIQLPPNYGPDYTRKFRAIYPALAKQHDIALVPFMLEGVKPEQFQADNLH
PNAEAQRGIMQHILHSLIPLLD
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctttctgaaaatagcattgctcatagccgcactggcgctgtcctgctcggca
caggcagcaaagaacatcctgctgttcggcgacagtttatcagccggttacgggattgag
cgcgacgattcatgggcgaatttattgcagcaggagttgaaaaaaagccaccctcagtat
gaagtggtgaatgccagcatcagcggcgagaccactgcgggtgggctgcgccgtatcggc
aaggctttgcagcaacaccggcctgcggtggtcgtcgtcgaactcggtgccaacgacggg
ctgcgcggcggcgccatccccgagatgaagaagaacctggacaggataatcacccaggcg
cagaaagccaacgccagggtgctgttgctcggtatccagctgccgccgaactatggcccg
gactacaccaggaaattccgcgcgatatatccggctctggcgaaacagcacgacatcgcg
ctggttcccttcatgctggagggggtaaaaccggaacaattccaagccgacaatctgcat
ccgaacgcagaagcacaacggggtatcatgcagcacatcctgcactccttgatacccctg
ctagactga

DBGET integrated database retrieval system