KEGG   Sideroxydans lithotrophicus: Slit_1762Help
Entry
Slit_1762         CDS       T01196                                 

Definition
(RefSeq) GMC oxidoreductase
  KO
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
slt  Sideroxydans lithotrophicus
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Slit_1762
Enzymes [BR:slt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Slit_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1774030..1775838)
Genome map
AA seq 602 aa AA seqDB search
MEQNSPGGNGGEFTEKLEAVVIGSGFGGAISCCRLAQKWGTGVLLLERGKRYPMGAFPRS
PHQMADNFWSDPSDKVRRPRHMRGKGLRGMYDIRNYSRMDAVVCAGLGGGSLIYANVFLE
PPDEVFAANWPAGVDREFLQPYYDVARTVLGARPIPPWENDKRRHVSRTGLFRDFAREQG
RESRLADICVFFGNDYNYKDPHAAPAAIGLQEKNRYGATQTSCTYCGECDVGCNTHSKNT
VDLNYLHVAEHVHGARIQTESLVEKIVPLNELGGEDAAADGRFGYRVHYRHLDQGAAWVD
TQRVVVSAGTLGTNELLLRCRDVHGSLPRISRQLGRRFSGNGDFVSFAAVGERIADPNYG
PVITQYTDFNLLKAHDPERAFILEDASYPVFLAWFIEGMQPMLSPLGVARKIWRAIKWLW
RRIRQMLFGGKWSGQVADLFHEMLRGDLSYRSSVLLCMGLDKGDGVLSLKDGHLDIQWPQ
ATSMPLYRAIVDCGRKFKSFVGAAFFTPLPTWKWPLRNNITVHPLGGCAMAHDAEHGVVS
AGSDRGQVFGYQGLYVADGSLMPGALGANPAATISAVSEWIAEGITGTVPSGDLGAHVPR
QG
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaatagtcctggcggtaatggcggagaatttactgaaaagcttgaagctgtc
gtcatcggcagcggtttcggcggcgccatcagttgctgtcgcctggcgcagaagtggggc
acaggcgtgctgctgctggaacgcggcaagcgctatccgatgggtgctttcccgcgctct
ccgcatcagatggccgacaatttctggagcgacccatccgacaaggtgcgccgccccagg
catatgcgcggcaaggggctgcgcggcatgtatgacatccgcaactactccaggatggat
gccgtggtctgcgccgggctgggcggcggatcgctgatctatgccaacgtgttcctggaa
ccgcccgacgaggtgttcgccgccaattggcctgccggagtggatcgggaattcctgcag
ccctattacgacgttgccagaaccgttctcggtgcgcgccccattccgccctgggaaaac
gacaagcgccgtcacgtcagccgcaccggcttgttccgggatttcgcccgcgagcagggg
cgcgaatcgaggcttgccgacatttgcgtgttcttcggcaacgactacaactataaagat
ccgcacgctgcaccagcagccatcggcctgcaggaaaagaaccgctacggcgcgacgcag
acctcttgcacctattgcggcgaatgcgacgtgggctgcaacacgcactcgaagaacacc
gtggatctgaattatctgcatgtcgccgagcatgtgcacggggcgcgcatccagaccgag
tccctggtggagaagatcgttccgctgaacgagcttggcggcgaggatgccgctgcagat
ggccggttcggctaccgggtgcattaccgtcatctcgatcaaggtgctgcctgggtcgac
acacagcgtgtcgtggtctctgccggaacattgggaacgaacgagttgctgctgcgctgc
cgcgatgtgcatggctcgttgccgcgtatcagccggcaactggggcggcgtttctccggc
aatggcgatttcgtttccttcgccgccgtgggggagaggatcgccgatcccaattacggg
ccggtgatcacccagtacacggatttcaacctgctcaaggcgcacgatccggagcgggcc
ttcattctggaagacgccagttatccggtcttcctggcctggttcatcgaaggcatgcag
cccatgctgagcccgttgggagtggcgagaaagatctggcgcgcgatcaagtggctgtgg
cggcgcatcaggcaaatgctgtttggcggaaaatggagcggacaggtcgccgatcttttc
catgagatgctccggggcgacctgtcatatcgcagcagcgtgcttctgtgcatgggactg
gacaagggcgacggcgtgctgtcgttgaaggatggccatctggatatccagtggccgcag
gcaaccagcatgccgctataccgagccatcgtcgattgcggcaggaagttcaagtcgttc
gtcggcgccgctttctttacgccgctgccgacctggaagtggccgttgcggaacaacatc
acggtccatcctctgggcggttgcgccatggcgcacgatgcggaacatggggtggtcagc
gcggggagcgaccgcggccaggttttcggctaccagggactgtatgttgcggacggttcg
ctcatgcccggggcgcttggtgccaacccggctgccaccatttccgcagtttccgagtgg
attgccgaggggattacaggtacagtcccgagtggcgaccttggcgcgcatgttccccgt
caaggataa

DBGET integrated database retrieval system