KEGG   Sideroxydans lithotrophicus: Slit_1762Help
Entry
Slit_1762         CDS       T01196                                 

Definition
GMC oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
slt  Sideroxydans lithotrophicus
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1774030..1775838)
Genome map
AA seq 602 aa AA seqDB search
MEQNSPGGNGGEFTEKLEAVVIGSGFGGAISCCRLAQKWGTGVLLLERGKRYPMGAFPRS
PHQMADNFWSDPSDKVRRPRHMRGKGLRGMYDIRNYSRMDAVVCAGLGGGSLIYANVFLE
PPDEVFAANWPAGVDREFLQPYYDVARTVLGARPIPPWENDKRRHVSRTGLFRDFAREQG
RESRLADICVFFGNDYNYKDPHAAPAAIGLQEKNRYGATQTSCTYCGECDVGCNTHSKNT
VDLNYLHVAEHVHGARIQTESLVEKIVPLNELGGEDAAADGRFGYRVHYRHLDQGAAWVD
TQRVVVSAGTLGTNELLLRCRDVHGSLPRISRQLGRRFSGNGDFVSFAAVGERIADPNYG
PVITQYTDFNLLKAHDPERAFILEDASYPVFLAWFIEGMQPMLSPLGVARKIWRAIKWLW
RRIRQMLFGGKWSGQVADLFHEMLRGDLSYRSSVLLCMGLDKGDGVLSLKDGHLDIQWPQ
ATSMPLYRAIVDCGRKFKSFVGAAFFTPLPTWKWPLRNNITVHPLGGCAMAHDAEHGVVS
AGSDRGQVFGYQGLYVADGSLMPGALGANPAATISAVSEWIAEGITGTVPSGDLGAHVPR
QG
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaatagtcctggcggtaatggcggagaatttactgaaaagcttgaagctgtc
gtcatcggcagcggtttcggcggcgccatcagttgctgtcgcctggcgcagaagtggggc
acaggcgtgctgctgctggaacgcggcaagcgctatccgatgggtgctttcccgcgctct
ccgcatcagatggccgacaatttctggagcgacccatccgacaaggtgcgccgccccagg
catatgcgcggcaaggggctgcgcggcatgtatgacatccgcaactactccaggatggat
gccgtggtctgcgccgggctgggcggcggatcgctgatctatgccaacgtgttcctggaa
ccgcccgacgaggtgttcgccgccaattggcctgccggagtggatcgggaattcctgcag
ccctattacgacgttgccagaaccgttctcggtgcgcgccccattccgccctgggaaaac
gacaagcgccgtcacgtcagccgcaccggcttgttccgggatttcgcccgcgagcagggg
cgcgaatcgaggcttgccgacatttgcgtgttcttcggcaacgactacaactataaagat
ccgcacgctgcaccagcagccatcggcctgcaggaaaagaaccgctacggcgcgacgcag
acctcttgcacctattgcggcgaatgcgacgtgggctgcaacacgcactcgaagaacacc
gtggatctgaattatctgcatgtcgccgagcatgtgcacggggcgcgcatccagaccgag
tccctggtggagaagatcgttccgctgaacgagcttggcggcgaggatgccgctgcagat
ggccggttcggctaccgggtgcattaccgtcatctcgatcaaggtgctgcctgggtcgac
acacagcgtgtcgtggtctctgccggaacattgggaacgaacgagttgctgctgcgctgc
cgcgatgtgcatggctcgttgccgcgtatcagccggcaactggggcggcgtttctccggc
aatggcgatttcgtttccttcgccgccgtgggggagaggatcgccgatcccaattacggg
ccggtgatcacccagtacacggatttcaacctgctcaaggcgcacgatccggagcgggcc
ttcattctggaagacgccagttatccggtcttcctggcctggttcatcgaaggcatgcag
cccatgctgagcccgttgggagtggcgagaaagatctggcgcgcgatcaagtggctgtgg
cggcgcatcaggcaaatgctgtttggcggaaaatggagcggacaggtcgccgatcttttc
catgagatgctccggggcgacctgtcatatcgcagcagcgtgcttctgtgcatgggactg
gacaagggcgacggcgtgctgtcgttgaaggatggccatctggatatccagtggccgcag
gcaaccagcatgccgctataccgagccatcgtcgattgcggcaggaagttcaagtcgttc
gtcggcgccgctttctttacgccgctgccgacctggaagtggccgttgcggaacaacatc
acggtccatcctctgggcggttgcgccatggcgcacgatgcggaacatggggtggtcagc
gcggggagcgaccgcggccaggttttcggctaccagggactgtatgttgcggacggttcg
ctcatgcccggggcgcttggtgccaacccggctgccaccatttccgcagtttccgagtgg
attgccgaggggattacaggtacagtcccgagtggcgaccttggcgcgcatgttccccgt
caaggataa

DBGET integrated database retrieval system