KEGG   Sideroxydans lithotrophicus: Slit_1811Help
Entry
Slit_1811         CDS       T01196                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:slt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1829448..1831619)
Genome map
AA seq 723 aa AA seqDB search
MPSETQNKRSILEARHHDPFSYLGLHQNKSGWVLRVFQPHATEVAVHDGDAWQALDRDSS
SGFYIWQGKQSLPAPCRLRINFFNHVVEIHDAYSFGSSITDHDLYLFSEGRLEQAYRMLG
AHHMEVQGVWGVRFAVWAPNAERVSVVGDFNGWDGRIYPMRALGSTGVWEIFVPDIGLGE
FYKFEIRNRHSGEVFAKTDPYGLSFEMRPGTAARVSVLDGYQWRDSAWQGQRASRDWMHE
SLSVYEIHAGSWKRHWDGRFYNFRELADSLVPYVQEMGFSYIELMPISEHPLDESWGYQT
TGYYGVTSRFGTPDDFRYFVDACHVVGIGVILDWVPAHFPKDSWALARFDGTALYEHEDP
RLGEHQDWGTLIFNYGRNEVRNFLLANAHYWLSEFHIDGLRVDAVASMLYLDYSRKAGQW
LPNKFGGRENIEAVDFFRELNVMTHERFPGTLTLAEESTSWPMVSRPTYLGGLGFSMKWN
MGWMNDTLDYIEHDPVHRRYHHNSLTFGQLYSYTENFVLPFSHDEVVHGKKSLIDKMPGD
SWQKFANLRLLFTYQMTYPGKKLNFMGNEFAQGHEWKVGSELDWYLLGRSEHSGVQSTLR
DLNRLYSDVPALHELDFSHEGFEWIDCNSADQSVLSYRRIARDGSYVVVVLNFTPVPREG
YRVGVRHKGCYREIFNSDSHYYGGSNMGNGLGMDTSDMSWNGEMQSLALTLPPLAGIVLQ
RVS
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtgaaactcagaacaagcgctccattcttgaggcgcgccatcatgaccccttt
tcatatctggggctgcatcagaacaagtcaggctgggttctgcgcgtgtttcaacctcat
gcgaccgaggtcgcggtgcatgacggcgacgcatggcaagctctcgatcgcgacagttcc
agtggtttctatatttggcagggcaagcagtcccttcccgccccgtgccgcctgaggatc
aattttttcaatcatgtggtcgagatacatgatgcctacagttttggcagcagcatcacc
gatcacgatctgtatcttttctcggaaggtcgtctggaacaggcataccgcatgcttggt
gcgcaccacatggaggtgcagggcgtgtggggtgtgcgttttgctgtatgggcgccgaat
gccgagcgcgtcagcgtggtgggcgatttcaacggctgggacgggcgtatctatccgatg
cgcgcgctgggcagcaccggcgtgtgggagatattcgtgcccgacatcggtttgggggaa
ttctataagttcgagatacgcaatcgccactccggcgaggtgttcgccaagaccgacccc
tatggcttgagcttcgagatgcgtcccggcactgcagccagggtgtcggtgctggacggt
tatcagtggcgcgattcggcatggcaggggcagcgtgccagccgcgactggatgcacgaa
tcgctgagcgtttatgagatccatgccggttcatggaagcggcattgggacgggcgcttc
tacaatttccgcgagttggccgacagcctggtgccttatgtgcaggagatgggcttctcg
tatatcgaactgatgccgatcagcgagcatccgctggatgaatcctggggctatcagacc
acaggctattacggtgtgaccagccgtttcggcacgccggacgatttcaggtatttcgtc
gatgcctgccacgttgtcggtatcggcgtgatcctcgactgggtgccggcgcattttccc
aaggacagctgggcgctggcgcgtttcgacggtacggcattgtatgaacatgaggatccg
agactgggcgagcatcaggactggggcacgctgatcttcaattacgggcgcaacgaagtg
cgcaatttcctgctggccaacgcccactactggctgagcgagttccacatcgacggtttg
cgcgtggatgcggtggcttccatgctgtatctggattattcgcgcaaggccgggcaatgg
ctgccgaacaagttcggcggtcgcgagaacatcgaggcggtggatttcttccgtgagttg
aacgtgatgacgcatgagcgttttcccggcacgttgaccctggccgaggagtccacttcc
tggcccatggtgtcgcgcccgacctatctgggcgggctgggtttcagcatgaagtggaac
atgggctggatgaacgataccctcgactacatcgagcacgatccggtacaccgcagatac
caccataacagcctgaccttcggccagctctacagctataccgagaacttcgtgctgccg
ttctcgcatgacgaagtggtacacggtaaaaaatccctgatcgacaagatgcctggagat
tcctggcagaaattcgccaatctgcgtttgctgttcacttatcagatgacctacccgggc
aagaaactcaatttcatgggtaatgaattcgcacagggccatgagtggaaagtaggttca
gagctggactggtatctgcttggccgcagcgagcattctggcgtccagtccacattgcgc
gacctgaaccggctgtattccgatgtgcccgcactgcatgagctggatttttcccacgag
ggctttgagtggatagattgcaacagtgccgaccagtcggtgctgagctatcgccgcatt
gctcgcgatggttcatatgtggtggtggtcctcaatttcacaccggtgccgcgcgagggg
tatcgcgtaggtgtgcggcacaagggttgttaccgcgagatattcaacagcgactcgcac
tactatggcggttccaacatgggcaacggtctgggcatggatacctcggacatgagctgg
aacggcgaaatgcaatcgctggcactgacgctgccgccgttggcgggcatcgtattgcag
cgggtgtcctga

DBGET integrated database retrieval system