KEGG   Sideroxydans lithotrophicus: Slit_1976Help
Entry
Slit_1976         CDS       T01196                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:slt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:slt00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:slt00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:slt00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:slt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1991614..1993581
Genome map
AA seq 655 aa AA seqDB search
MSNIQSVLHETRVFNPTDDFVKQANVSGMASYRAMCDAAAKDYAGFWANLARETILWHKP
FTRTLDESKAPFYKWFEDGELNVSYNCLDRHLATQPEKNAIIFEADDGKVTKVSYRELHG
RVCQFANGLKSRGIKKGDRVIVYMPMSVEAVVAMQACARIGAIHSVVFGGFSSKSLHERI
TDAQAVAVITADGQFRGGKAMALKPAVDEALSLGGCKAVHTVIVYRRTGGEVQWDDNTNV
WWHDLFNSQPSACEPEWVGAEHPLFILYTSGSTGKPKGVQHSTAGYLLGTMVSLQWVFDY
KPSDIFWCTADVGWITGHSYVAYGPLAMGATQVIFEGVPTYPDAGRFWKMIQDHKVTTFY
TAPTAIRSLIKLGGDLPKQYDLSSLRLLGTVGEPINPEAWMWYYTVVGQSRCPIVDTWWQ
TETGCHMIAPLPGAMPIKPGTCTLPLPGIMATIVNEAGDEVHDQHGGFLVIKKPFPSQIR
TIWGDPERYKKGYFPEEMHGAYLAGDSAHRDEDGYFWIMGRIDDVLNVSGHRLGTMEIES
ALVSNPLVAEAAVVGKPHEIKGEAVVAFVVLKGSRPADAAAAKKLAEELRNWVGKEIGPI
AKPDEIRFGENLPKTRSGKIMRRLLRAVAKGEEITQDVSTLENPAILEQLKEVIK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatatccagtccgtcctgcacgaaacacgcgtgttcaaccctacagacgatttc
gtcaaacaagccaatgtatccggcatggccagttatcgcgcgatgtgcgatgcggcagca
aaagactatgcagggttctgggcaaatctggcacgcgaaaccatcctctggcacaaacct
ttcaccaggacactggacgagagcaaggcccctttttacaaatggttcgaagacggcgaa
ttgaacgtttcatacaattgcctggatcggcatctggcgacacaaccggaaaagaacgcc
atcatattcgaagccgacgacggcaaggtcaccaaggtcagctaccgcgagttgcatggc
cgcgtctgccagttcgccaatggcctgaaatcgcgcggcatcaaaaagggcgaccgggtg
atcgtttacatgcccatgagtgtggaggcggtcgtcgccatgcaggcctgtgcccgtatc
ggcgcgatccactcggtcgtattcggcggtttttcatccaagagcttgcatgaacgcatc
accgacgcacaggcagtggcagtcatcacggccgacggccagtttcgcggcggcaaggcc
atggcactgaaacccgcagtggatgaagcgctcagcctgggcggatgcaaagcggtgcac
accgtcatcgtctatcgccgcaccggcggtgaagtgcaatgggacgacaacaccaatgtg
tggtggcacgacctgttcaattcgcaaccctcggcctgcgaacctgaatgggtgggggcc
gaacatccgctgttcatcctgtacacctccggctcaaccggcaaacccaagggcgtgcaa
cactccaccgctggttacctgctgggtaccatggtttcattgcaatgggtattcgattac
aagccttcagacatcttctggtgcactgccgacgtgggctggatcaccggtcacagctac
gttgcttatggccctttggccatgggtgcgacacaggtcatctttgaaggcgtgccgacc
tatcccgatgccggtcgcttctggaaaatgatccaggatcacaaggtcacgaccttctac
accgcgcccaccgccattcgctctctgatcaaactgggtggagatttgccgaaacaatac
gacctgtcatccttgcgactgctcggcacagtcggcgaaccgatcaatccggaagcttgg
atgtggtactacaccgttgttggccaatcgcgctgccctatcgtcgatacctggtggcaa
accgagaccggctgccacatgatcgccccgctgcccggtgcaatgccgatcaaacccggc
acctgtaccctgccgctgcccggcatcatggccaccatcgtcaatgaagcaggcgatgaa
gtccatgaccagcatggcggtttcctcgtcatcaaaaagcctttcccgtcgcagatccgc
accatctggggcgatccggaacgctacaagaaaggctacttcccggaagagatgcatggc
gcctacctcgcgggagattctgcccaccgcgatgaagacggctacttctggatcatggga
cgtatcgacgacgtgctgaacgtctccggccaccgtctgggcaccatggaaatcgagtct
gccctggtctccaacccgctggttgcggaagctgccgtggtcggcaagccgcacgagatc
aaaggcgaagcagtggtcgctttcgtggtcttgaagggttcgcgcccggccgatgctgct
gccgcaaaaaaactggcagaagaactgcgcaactgggtcggcaaggagatcggcccgatc
gccaagcctgacgagatccgtttcggcgaaaatctgcccaagacacggtcaggcaagatc
atgcgccggttgctgcgtgccgtcgccaaaggcgaagagatcacccaggatgtttcgact
ctggaaaatcccgccatccttgagcaactgaaggaagtcatcaagtaa

DBGET integrated database retrieval system