KEGG   Sideroxydans lithotrophicus: Slit_1976Help
Entry
Slit_1976         CDS       T01196                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Slit_1976
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slit_1976
   00620 Pyruvate metabolism
    Slit_1976
   00640 Propanoate metabolism
    Slit_1976
  Energy metabolism
   00680 Methane metabolism
    Slit_1976
Enzymes [BR:slt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Slit_1976
Lipid biosynthesis proteins [BR:slt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Slit_1976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1991614..1993581
Genome map
AA seq 655 aa AA seqDB search
MSNIQSVLHETRVFNPTDDFVKQANVSGMASYRAMCDAAAKDYAGFWANLARETILWHKP
FTRTLDESKAPFYKWFEDGELNVSYNCLDRHLATQPEKNAIIFEADDGKVTKVSYRELHG
RVCQFANGLKSRGIKKGDRVIVYMPMSVEAVVAMQACARIGAIHSVVFGGFSSKSLHERI
TDAQAVAVITADGQFRGGKAMALKPAVDEALSLGGCKAVHTVIVYRRTGGEVQWDDNTNV
WWHDLFNSQPSACEPEWVGAEHPLFILYTSGSTGKPKGVQHSTAGYLLGTMVSLQWVFDY
KPSDIFWCTADVGWITGHSYVAYGPLAMGATQVIFEGVPTYPDAGRFWKMIQDHKVTTFY
TAPTAIRSLIKLGGDLPKQYDLSSLRLLGTVGEPINPEAWMWYYTVVGQSRCPIVDTWWQ
TETGCHMIAPLPGAMPIKPGTCTLPLPGIMATIVNEAGDEVHDQHGGFLVIKKPFPSQIR
TIWGDPERYKKGYFPEEMHGAYLAGDSAHRDEDGYFWIMGRIDDVLNVSGHRLGTMEIES
ALVSNPLVAEAAVVGKPHEIKGEAVVAFVVLKGSRPADAAAAKKLAEELRNWVGKEIGPI
AKPDEIRFGENLPKTRSGKIMRRLLRAVAKGEEITQDVSTLENPAILEQLKEVIK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatatccagtccgtcctgcacgaaacacgcgtgttcaaccctacagacgatttc
gtcaaacaagccaatgtatccggcatggccagttatcgcgcgatgtgcgatgcggcagca
aaagactatgcagggttctgggcaaatctggcacgcgaaaccatcctctggcacaaacct
ttcaccaggacactggacgagagcaaggcccctttttacaaatggttcgaagacggcgaa
ttgaacgtttcatacaattgcctggatcggcatctggcgacacaaccggaaaagaacgcc
atcatattcgaagccgacgacggcaaggtcaccaaggtcagctaccgcgagttgcatggc
cgcgtctgccagttcgccaatggcctgaaatcgcgcggcatcaaaaagggcgaccgggtg
atcgtttacatgcccatgagtgtggaggcggtcgtcgccatgcaggcctgtgcccgtatc
ggcgcgatccactcggtcgtattcggcggtttttcatccaagagcttgcatgaacgcatc
accgacgcacaggcagtggcagtcatcacggccgacggccagtttcgcggcggcaaggcc
atggcactgaaacccgcagtggatgaagcgctcagcctgggcggatgcaaagcggtgcac
accgtcatcgtctatcgccgcaccggcggtgaagtgcaatgggacgacaacaccaatgtg
tggtggcacgacctgttcaattcgcaaccctcggcctgcgaacctgaatgggtgggggcc
gaacatccgctgttcatcctgtacacctccggctcaaccggcaaacccaagggcgtgcaa
cactccaccgctggttacctgctgggtaccatggtttcattgcaatgggtattcgattac
aagccttcagacatcttctggtgcactgccgacgtgggctggatcaccggtcacagctac
gttgcttatggccctttggccatgggtgcgacacaggtcatctttgaaggcgtgccgacc
tatcccgatgccggtcgcttctggaaaatgatccaggatcacaaggtcacgaccttctac
accgcgcccaccgccattcgctctctgatcaaactgggtggagatttgccgaaacaatac
gacctgtcatccttgcgactgctcggcacagtcggcgaaccgatcaatccggaagcttgg
atgtggtactacaccgttgttggccaatcgcgctgccctatcgtcgatacctggtggcaa
accgagaccggctgccacatgatcgccccgctgcccggtgcaatgccgatcaaacccggc
acctgtaccctgccgctgcccggcatcatggccaccatcgtcaatgaagcaggcgatgaa
gtccatgaccagcatggcggtttcctcgtcatcaaaaagcctttcccgtcgcagatccgc
accatctggggcgatccggaacgctacaagaaaggctacttcccggaagagatgcatggc
gcctacctcgcgggagattctgcccaccgcgatgaagacggctacttctggatcatggga
cgtatcgacgacgtgctgaacgtctccggccaccgtctgggcaccatggaaatcgagtct
gccctggtctccaacccgctggttgcggaagctgccgtggtcggcaagccgcacgagatc
aaaggcgaagcagtggtcgctttcgtggtcttgaagggttcgcgcccggccgatgctgct
gccgcaaaaaaactggcagaagaactgcgcaactgggtcggcaaggagatcggcccgatc
gccaagcctgacgagatccgtttcggcgaaaatctgcccaagacacggtcaggcaagatc
atgcgccggttgctgcgtgccgtcgccaaaggcgaagagatcacccaggatgtttcgact
ctggaaaatcccgccatccttgagcaactgaaggaagtcatcaagtaa

DBGET integrated database retrieval system