KEGG   Sideroxydans lithotrophicus: Slit_2074Help
Entry
Slit_2074         CDS       T01196                                 

Definition
Aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slit_2074
Enzymes [BR:slt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Slit_2074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2092887..2093789
Genome map
AA seq 300 aa AA seqDB search
MNQAELNQRYAIGNHVQFKEIAAGMIVAEVANQHALANIALQGAHIATFQPRGEEPVIWL
SPLAKFVPGKSIRGGVPICWPWFGPHKSDSKLPGHGYARTVPWEVLETMALSDGSTFLRF
GLVESDATGAQWPHSSSVQLEVTVGKSLRVELVTVNTGTAAFELGEALHTYFQISDVAKM
TIRGLENCAYLDKVQDFARFTQKDGIVIESEVDRVYINTAADCVIEDKGMKRAIRIAKQG
SMSTVVWNPWTEKADKMGDFGEDGHRGMVCVESGNALENVVVLAPGETHKLVAVYSVEKL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagctgaactcaaccagcgctacgccatcggcaaccacgtgcaattcaaggag
atcgccgccggcatgatcgtcgccgaagtcgccaaccagcacgccctcgccaacatcgca
ttgcagggcgcgcatatcgccaccttccagccgcgcggcgaggagccggtgatctggctg
tcgccgctggccaaattcgtaccaggcaaatccatccgcggcggcgtgccgatctgctgg
ccatggttcggcccgcacaagagcgacagcaagctgcccggtcacggctatgcgcgcacc
gtgccttgggaagtgctggaaaccatggcgctgagcgatggctcgactttcctgcgcttc
ggcctggtcgagagcgatgccaccggcgcacaatggccccactcatcctcggtgcaactg
gaagtgactgtgggcaaatcattgcgagtggaactggttaccgtcaatacgggtacggcg
gcattcgaactcggcgaagcgttgcatacctacttccagatcagcgatgtcgccaagatg
accatccgcggcctggagaactgcgcctacctggacaaggtgcaggacttcgcgcgtttc
acccagaaggacggcatcgtcatcgaaagcgaagtggatcgcgtgtacatcaacaccgca
gcggattgcgtgatcgaggacaagggcatgaaacgcgccatccgcatcgccaagcaaggc
agcatgtccaccgtggtgtggaacccgtggaccgagaaagccgacaagatgggcgacttc
ggcgaagatggccatcgcggcatggtgtgcgtggagagcggcaatgcgctggaaaacgtc
gtggtgctcgcaccgggcgagacgcacaagctggtggcggtatacagcgtcgaaaagctg
taa

DBGET integrated database retrieval system