KEGG   Sideroxydans lithotrophicus: Slit_2101Help
Entry
Slit_2101         CDS       T01196                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00010  Glycolysis / Gluconeogenesis
slt00030  Pentose phosphate pathway
slt00051  Fructose and mannose metabolism
slt00052  Galactose metabolism
slt00230  Purine metabolism
slt00500  Starch and sucrose metabolism
slt00520  Amino sugar and nucleotide sugar metabolism
slt00521  Streptomycin biosynthesis
slt01100  Metabolic pathways
slt01110  Biosynthesis of secondary metabolites
slt01120  Microbial metabolism in diverse environments
slt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slit_2101
   00030 Pentose phosphate pathway
    Slit_2101
   00051 Fructose and mannose metabolism
    Slit_2101
   00052 Galactose metabolism
    Slit_2101
   00500 Starch and sucrose metabolism
    Slit_2101
   00520 Amino sugar and nucleotide sugar metabolism
    Slit_2101
  Nucleotide metabolism
   00230 Purine metabolism
    Slit_2101
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Slit_2101
Enzymes [BR:slt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Slit_2101
    5.4.2.8  phosphomannomutase
     Slit_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV YadA_head
Motif
Other DBs
NCBI-ProteinID: ADE12329
UniProt: D5CU17
Position
2127721..2129097
Genome map
AA seq 458 aa AA seqDB search
MANLPKEIFKAYDIRGIVSKSLTNEIVESIGHAIGSEAVARNQHSIAIGRDGRLSGPEFA
RSLARGIQKSGINVIDVGRVATPMTYFAAFQLKTDCAVMITGSHNPPDYNGLKMVLAGET
LSGETIQKLRQRIETNDLEHGNGGYSQYDIAPEYLARIIGDIKLTRPLKITVDCGNGVAG
DFAAKLYRGIGCSVTELFCEVDGNFPNHHPDPSDPHNLEDLIAALRGNDSELGLAFDGDG
DRLGVVTKDGKIIFPDRQLMLFAADVLSRNAGAEIIFDVKSTRNLFPWIRERGGKPILWK
TGHSLVKAKMKETGALLAGEMSGHVFFKERWYGFDDGLYAGARLLEILSKVADANATLNA
LPDAVCTPELHIHTAEGVNHSLIALLQKEARFPDAKDIITIDGLRVEYADGFGLMRPSNT
TPVIVLRFEADNVAALQRIQNDFRRVLLNAESSLTLPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccttcccaaagagatattcaaggcctacgacatacgcggcatcgtcagcaag
tcgctgaccaatgagatcgtggaatccatcgggcatgccatcggctcggaagcggtcgca
cgcaatcagcacagcatcgccatcggccgcgacggccgactgtcgggtcccgaattcgct
aggtcgctggcccgcggcatccagaagagcggcatcaacgtcatcgacgtaggtcgcgtt
gccacgccgatgacctactttgccgccttccagctcaagaccgattgcgcggtgatgatc
accggcagccacaatccacctgattacaacggcctcaagatggtgctggcaggtgaaacg
ctgtccggtgaaaccatccagaaactgcgccagcgtatcgaaacgaacgatctcgagcac
ggtaacggcggctattcgcaatacgatatcgcgccggaatatctggcgcgcatcatcggc
gacatcaagctgacgcgtccgctgaagatcacggtggactgtggcaacggcgtggccggg
gatttcgccgccaaactctatcgcggcatcggctgtagcgtcaccgagctgttctgcgag
gtggacggcaacttccccaaccaccaccccgacccctccgatccacacaacctggaagac
ctgatcgccgccctgcgcggcaacgacagcgaactgggactggcattcgacggcgacggc
gaccgtctcggcgtggtcaccaaggacggcaagatcatcttcccagaccgtcagctgatg
ctgttcgcagccgatgtgctgagccgaaatgcgggcgccgagatcatcttcgacgtgaaa
tccacgcgcaacctgttcccgtggatacgcgagcgcggcggcaagccgatcctgtggaag
accggccattcgctggtcaaggccaagatgaaggagaccggcgcgctgctcgcaggcgag
atgagcgggcacgtgttcttcaaggagcgctggtatggcttcgacgacggactgtatgcg
ggagcgcgcttgctggagatattgagcaaggtcgccgacgccaatgccacgctgaatgcc
ctgccggacgcggtttgcacgccagaactgcatatccatacggccgagggcgtgaaccac
agcctgatcgcgctcttgcaaaaggaagcccgctttcccgatgccaaagacatcatcact
atcgacggactgcgcgtggaatatgccgacgggttcgggctgatgcgcccctcaaacact
acgccggtgatcgtgctgcgtttcgaagcggacaatgttgctgctctgcagcgtattcag
aacgacttccgtcgtgtgttactgaatgcggaaagcagtctgacgcttccgttctga

DBGET integrated database retrieval system