KEGG   Sideroxydans lithotrophicus: Slit_2101Help
Entry
Slit_2101         CDS       T01196                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:slt00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:slt00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:slt00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:slt00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:slt00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:slt00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:slt00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:slt00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2127721..2129097
Genome map
AA seq 458 aa AA seqDB search
MANLPKEIFKAYDIRGIVSKSLTNEIVESIGHAIGSEAVARNQHSIAIGRDGRLSGPEFA
RSLARGIQKSGINVIDVGRVATPMTYFAAFQLKTDCAVMITGSHNPPDYNGLKMVLAGET
LSGETIQKLRQRIETNDLEHGNGGYSQYDIAPEYLARIIGDIKLTRPLKITVDCGNGVAG
DFAAKLYRGIGCSVTELFCEVDGNFPNHHPDPSDPHNLEDLIAALRGNDSELGLAFDGDG
DRLGVVTKDGKIIFPDRQLMLFAADVLSRNAGAEIIFDVKSTRNLFPWIRERGGKPILWK
TGHSLVKAKMKETGALLAGEMSGHVFFKERWYGFDDGLYAGARLLEILSKVADANATLNA
LPDAVCTPELHIHTAEGVNHSLIALLQKEARFPDAKDIITIDGLRVEYADGFGLMRPSNT
TPVIVLRFEADNVAALQRIQNDFRRVLLNAESSLTLPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccttcccaaagagatattcaaggcctacgacatacgcggcatcgtcagcaag
tcgctgaccaatgagatcgtggaatccatcgggcatgccatcggctcggaagcggtcgca
cgcaatcagcacagcatcgccatcggccgcgacggccgactgtcgggtcccgaattcgct
aggtcgctggcccgcggcatccagaagagcggcatcaacgtcatcgacgtaggtcgcgtt
gccacgccgatgacctactttgccgccttccagctcaagaccgattgcgcggtgatgatc
accggcagccacaatccacctgattacaacggcctcaagatggtgctggcaggtgaaacg
ctgtccggtgaaaccatccagaaactgcgccagcgtatcgaaacgaacgatctcgagcac
ggtaacggcggctattcgcaatacgatatcgcgccggaatatctggcgcgcatcatcggc
gacatcaagctgacgcgtccgctgaagatcacggtggactgtggcaacggcgtggccggg
gatttcgccgccaaactctatcgcggcatcggctgtagcgtcaccgagctgttctgcgag
gtggacggcaacttccccaaccaccaccccgacccctccgatccacacaacctggaagac
ctgatcgccgccctgcgcggcaacgacagcgaactgggactggcattcgacggcgacggc
gaccgtctcggcgtggtcaccaaggacggcaagatcatcttcccagaccgtcagctgatg
ctgttcgcagccgatgtgctgagccgaaatgcgggcgccgagatcatcttcgacgtgaaa
tccacgcgcaacctgttcccgtggatacgcgagcgcggcggcaagccgatcctgtggaag
accggccattcgctggtcaaggccaagatgaaggagaccggcgcgctgctcgcaggcgag
atgagcgggcacgtgttcttcaaggagcgctggtatggcttcgacgacggactgtatgcg
ggagcgcgcttgctggagatattgagcaaggtcgccgacgccaatgccacgctgaatgcc
ctgccggacgcggtttgcacgccagaactgcatatccatacggccgagggcgtgaaccac
agcctgatcgcgctcttgcaaaaggaagcccgctttcccgatgccaaagacatcatcact
atcgacggactgcgcgtggaatatgccgacgggttcgggctgatgcgcccctcaaacact
acgccggtgatcgtgctgcgtttcgaagcggacaatgttgctgctctgcagcgtattcag
aacgacttccgtcgtgtgttactgaatgcggaaagcagtctgacgcttccgttctga

DBGET integrated database retrieval system