KEGG   Sideroxydans lithotrophicus: Slit_2101Help
Entry
Slit_2101         CDS       T01196                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Slit_2101
   00030 Pentose phosphate pathway
    Slit_2101
   00051 Fructose and mannose metabolism
    Slit_2101
   00052 Galactose metabolism
    Slit_2101
   00500 Starch and sucrose metabolism
    Slit_2101
   00520 Amino sugar and nucleotide sugar metabolism
    Slit_2101
  Nucleotide metabolism
   00230 Purine metabolism
    Slit_2101
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Slit_2101
Enzymes [BR:slt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Slit_2101
    5.4.2.8  phosphomannomutase
     Slit_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2127721..2129097
Genome map
AA seq 458 aa AA seqDB search
MANLPKEIFKAYDIRGIVSKSLTNEIVESIGHAIGSEAVARNQHSIAIGRDGRLSGPEFA
RSLARGIQKSGINVIDVGRVATPMTYFAAFQLKTDCAVMITGSHNPPDYNGLKMVLAGET
LSGETIQKLRQRIETNDLEHGNGGYSQYDIAPEYLARIIGDIKLTRPLKITVDCGNGVAG
DFAAKLYRGIGCSVTELFCEVDGNFPNHHPDPSDPHNLEDLIAALRGNDSELGLAFDGDG
DRLGVVTKDGKIIFPDRQLMLFAADVLSRNAGAEIIFDVKSTRNLFPWIRERGGKPILWK
TGHSLVKAKMKETGALLAGEMSGHVFFKERWYGFDDGLYAGARLLEILSKVADANATLNA
LPDAVCTPELHIHTAEGVNHSLIALLQKEARFPDAKDIITIDGLRVEYADGFGLMRPSNT
TPVIVLRFEADNVAALQRIQNDFRRVLLNAESSLTLPF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccttcccaaagagatattcaaggcctacgacatacgcggcatcgtcagcaag
tcgctgaccaatgagatcgtggaatccatcgggcatgccatcggctcggaagcggtcgca
cgcaatcagcacagcatcgccatcggccgcgacggccgactgtcgggtcccgaattcgct
aggtcgctggcccgcggcatccagaagagcggcatcaacgtcatcgacgtaggtcgcgtt
gccacgccgatgacctactttgccgccttccagctcaagaccgattgcgcggtgatgatc
accggcagccacaatccacctgattacaacggcctcaagatggtgctggcaggtgaaacg
ctgtccggtgaaaccatccagaaactgcgccagcgtatcgaaacgaacgatctcgagcac
ggtaacggcggctattcgcaatacgatatcgcgccggaatatctggcgcgcatcatcggc
gacatcaagctgacgcgtccgctgaagatcacggtggactgtggcaacggcgtggccggg
gatttcgccgccaaactctatcgcggcatcggctgtagcgtcaccgagctgttctgcgag
gtggacggcaacttccccaaccaccaccccgacccctccgatccacacaacctggaagac
ctgatcgccgccctgcgcggcaacgacagcgaactgggactggcattcgacggcgacggc
gaccgtctcggcgtggtcaccaaggacggcaagatcatcttcccagaccgtcagctgatg
ctgttcgcagccgatgtgctgagccgaaatgcgggcgccgagatcatcttcgacgtgaaa
tccacgcgcaacctgttcccgtggatacgcgagcgcggcggcaagccgatcctgtggaag
accggccattcgctggtcaaggccaagatgaaggagaccggcgcgctgctcgcaggcgag
atgagcgggcacgtgttcttcaaggagcgctggtatggcttcgacgacggactgtatgcg
ggagcgcgcttgctggagatattgagcaaggtcgccgacgccaatgccacgctgaatgcc
ctgccggacgcggtttgcacgccagaactgcatatccatacggccgagggcgtgaaccac
agcctgatcgcgctcttgcaaaaggaagcccgctttcccgatgccaaagacatcatcact
atcgacggactgcgcgtggaatatgccgacgggttcgggctgatgcgcccctcaaacact
acgccggtgatcgtgctgcgtttcgaagcggacaatgttgctgctctgcagcgtattcag
aacgacttccgtcgtgtgttactgaatgcggaaagcagtctgacgcttccgttctga

DBGET integrated database retrieval system