KEGG   Sideroxydans lithotrophicus: Slit_2114Help
Entry
Slit_2114         CDS       T01196                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slit_2114
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slit_2114
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slit_2114
Enzymes [BR:slt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Slit_2114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2141207..2142004)
Genome map
AA seq 265 aa AA seqDB search
MSRIQATFDKLKQQQRKALIPFITAGDPSQQLTVPLMHGLVAAGADVLELGVPFSDPMAD
GPTIQRASERALRNGMSLRGVLGMVAEFRKQDTTTPVVLMGYGNPIEAMGWETFAQRCAE
VGVDGVLTVDFPPEESHEAFEHLQRHNIAPIFLLAPTTNEARIAQVAKLARGYVYYVSLK
GVTGAGNLDLAAIEQKLPQLRKHIKLPIGVGFGIRDAATARAVAGLCDGVVVGSRIVQEV
EDSTEQNVVANVGKLVKELRQAIDQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatccaagcgacctttgacaagctgaagcagcaacagcgcaaggcgctgatc
ccgttcatcacggccggcgacccgtcgcagcagctcactgtgccgctgatgcacggcttg
gtggctgccggtgcagatgtgttggaactcggtgtgccattctccgatccgatggcggac
ggcccgaccattcagcgcgcttccgagcgtgcgctcaggaacggcatgtcgctgcgcggc
gtgctgggcatggtggcggagttccgcaaacaggacacgaccacgccggtggtgctgatg
ggctatggtaacccgatcgaggccatgggctgggaaacattcgcgcaacgttgcgccgaa
gtcggcgtggacggtgtactgacggtggatttccccccggaagagagccacgaggcgttc
gagcatctgcagcgccacaacatcgcccccatcttcctgctggcgccgaccaccaacgaa
gcgcgcatagcccaagtcgccaagctggcgcgcggttatgtgtattacgtctcgctcaag
ggcgtcaccggtgcgggcaatctcgacctggcggccatcgagcagaaactgccgcagctg
cgcaagcacatcaagctgcccatcggcgtcggtttcggtatccgcgatgcagcgactgcc
agggctgtcgcggggttatgcgacggcgtggtggtgggcagccgcatcgtgcaggaagtc
gaggattcgaccgaacaaaatgtagtcgccaacgtgggtaaattggtgaaagaattgcgt
caggcgatcgatcaataa

DBGET integrated database retrieval system