KEGG   Sideroxydans lithotrophicus: Slit_2217Help
Entry
Slit_2217         CDS       T01196                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Slit_2217
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Slit_2217
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Slit_2217
Enzymes [BR:slt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Slit_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2247673..2249106)
Genome map
AA seq 477 aa AA seqDB search
MKYISTRGNAPAKTFTDILLGGLAPDGGLYLPEQYPQVTRAELDAWRKLSYADLAFAVLS
KFATDIPAADLKAIVSKTYTAQVYSNGRSDSNAADITPLRKLADNVYILELSNGPTLAFK
DMAMQLLGNLFEYALAKQHEELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPNGKMSAF
QRAQMYSLQDPNIHNIAINGMFDDAQDMVKAVSNDHAFKAKYKIGTVNSINWARVSAQIV
YYFKGYFAATKSNDEQVAFSVPSGNFGNICAGHIARMMGLPIGQLILATNENDVLDEFFR
TGVYRPRGTDHTYETSSPSMDISKASNFERFVFDLVGRDGAKVREFWSKVDKGGSFDIKG
TSYWNDLPKFDFASGKSTHQDRLKTIREVWQEYGVMVDTHTADGLKVGLEQRRPSLPLIC
LETALPAKFAETIREALGCEPERPAGLEGIEDLPQRCEVMDADVAKLKSFIATSVPL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatctccacccgcggcaacgcgcccgccaagaccttcaccgatatcctgctg
ggcggcctggcaccggacggtggcctgtacctgcccgagcagtacccgcaggtgacgcgc
gccgagctggatgcctggcgcaagctgtcgtatgccgatctggcctttgccgtcttgtcc
aagttcgccaccgacatcccggcggccgacctcaaggccatcgtcagcaaaacctatacc
gcgcaggtctacagcaacggccgcagcgacagcaacgctgccgacattaccccgctgcgc
aaactcgccgataacgtttacatcctcgaactctccaacggcccgacgctggcgttcaag
gacatggcgatgcagctgctcggcaacctgttcgaatatgcgttggcgaagcagcatgaa
gagctgaacatcttgggtgcgacttccggtgacaccggttccgctgccgaatacgccatg
cgcggcaagcgcggcatccgtgtgttcatgctgtcgccgaatggcaagatgtccgcgttt
cagcgcgcgcagatgtactcgctgcaggacccgaacatccacaacatcgccatcaacggc
atgttcgacgacgcgcaggacatggtgaaggcggtgtccaacgatcacgcgttcaaggcc
aaatacaagatcggcaccgtcaactcgatcaactgggcgcgcgtgtcggcgcaaatcgtg
tattacttcaagggctatttcgccgcgacgaaatccaacgacgagcaggtcgcgttctcg
gtgccgtccggcaacttcggcaacatctgcgccggccacatcgcgcgcatgatgggcctg
cccatcggccaactcatcctggcgaccaacgaaaacgacgtgctggatgagtttttccgc
accggcgtgtaccgtccgcgcggtaccgaccacacctacgagaccagcagcccgtcgatg
gatatcagcaaggccagcaacttcgagcgcttcgtgttcgacctggtcggtcgcgacggt
gccaaggtgcgcgaattctggagcaaggtggacaagggcggctcgttcgacatcaagggc
acttcatactggaacgatctgccgaagttcgacttcgcttccggcaagagcacgcaccag
gatcgcctcaagacgatccgcgaagtgtggcaggaatacggcgtgatggtggatacgcat
accgccgatggcctgaaagtcggtctggaacagcgtcgccccagcctgccgctgatctgc
ctggagactgcgctaccggccaagttcgccgaaacgatccgggaagcgctcgggtgcgag
ccggaacgtcctgccggtctggaaggtatcgaggatctgcctcagcgctgcgaagtgatg
gatgcggatgtggcgaaactcaagtcgttcatcgctacaagcgtaccgctgtaa

DBGET integrated database retrieval system