KEGG   Sideroxydans lithotrophicus: Slit_2411Help
Entry
Slit_2411         CDS       T01196                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Slit_2411
   00240 Pyrimidine metabolism
    Slit_2411
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Slit_2411
   03430 Mismatch repair
    Slit_2411
   03440 Homologous recombination
    Slit_2411
Enzymes [BR:slt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Slit_2411
DNA replication proteins [BR:slt03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Slit_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2434516..2434935
Genome map
AA seq 139 aa AA seqDB search
MTKVDFYTGSEDKLRTACQLSHKAMQNGLRVLLHAPDEATADKLDQLLWHYPPTAFMPHC
HSHEADAATLPVVIGRDEAFPHSELLISLHNACLPFFSRFERVIEIVSQDDADAKLGRER
YVFYKDRGYELRHFDLRKT
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtagatttctataccggcagcgaagacaagctgcgcaccgcctgtcagctg
agccacaaggcgatgcagaacggcctgcgcgtgctgctgcacgcacccgacgaggccact
gccgacaagctggaccagctgctgtggcattacccgcccaccgcattcatgccgcactgc
catagccatgaagcggatgccgccacgctgccggtggtcatcggccgcgacgaggcattt
cctcattccgagctgctgatcagcctgcacaacgcctgcctgccgttcttcagccgcttc
gagcgcgtcatcgagatcgtcagccaggatgacgccgatgccaaactgggacgcgagcgc
tatgtcttctacaaagaccgcggctacgagctgcgccacttcgacctgcgcaagacatga

DBGET integrated database retrieval system