KEGG   Sideroxydans lithotrophicus: Slit_2458Help
Entry
Slit_2458         CDS       T01196                                 

Definition
carbohydrate kinase, FGGY-like protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:slt00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2483903..2485303)
Genome map
AA seq 466 aa AA seqDB search
MSIAVALDLGTTTIKAGLLSQDGTLGGIVARPAPAIAAEAGCYESDGAAYAQTADEVLAA
CLVQTALRPPLGLCSQRSSFLIWERSSGTPVIPLISWQDDRGAESCAALQAQEGFIRDLT
GLPLAPYYLAPKLRVLLRGHPSWRERLLSGAWLLGKLDTYLIWRWTDGKHHLTDASMAAR
TLLMDIRRQQWSPALCKLFDIPRQILPQIGPSSGLALRLNNGLLLNASLADQSAALAASI
SPTRPEALVNLGTGGFVVCYLPEKRNAPDGYLQTLVWQDERQRVLLASEGTLNSIAAALA
PYPADACRVEELAGDDIFCLAEPSGLGAPYFRGDVGVTFSEAVAHLPSRHIALLLLEGII
FRVARILEDFHREFGIESAYLSGGLSGLHCLQQGIALCAPCTVYRLAQADASLSGAARLA
AGAPFAGHKEAARIDIPPAMGRLAEKFARWKVWLDGLVAASPSGRG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgccgtcgcactcgatctgggtacgacgacgatcaaggcaggattgttgtcg
caggatggcacgctcggcggtatcgtcgcgcgacccgcacccgcgatcgccgcggaagcg
gggtgttacgagagcgatggcgctgcatatgcacaaactgcggatgaggtattggcggca
tgcctggtacaaactgctttgcggccgccgctgggtctgtgcagccagcgttcttccttc
ctgatctgggagcgcagcagcggcacgccggtgataccgctgatctcgtggcaggacgac
aggggcgcggagagctgtgcggcgttacaggcgcaggaaggattcatccgcgatctcacc
ggcttgccgctcgcgccttactatcttgcccccaaactgcgcgtgctgctgcgcgggcat
ccctcctggcgcgaacgcctgctgagcggcgcatggttgctgggcaagctggatacctat
ctcatctggcgctggacggatggcaagcaccatctgaccgatgcctcgatggcggcacgt
accttgctgatggatatccgtcggcaacagtggtcgccagcattgtgcaaactgttcgat
attccgcggcagatactgccgcagatcgggccgtcttccggattggcgctgcgtctgaac
aacggcttgctgctgaatgccagcctggcagaccagtcggcggcattggcggccagcatc
tcccccacccggccggaagcgctggtcaatctggggacaggagggttcgtcgtctgctac
ctgccggagaagcggaacgcgccggatgggtatctgcaaaccctggtctggcaggacgag
cggcagcgggtgctgctggccagcgagggaacactcaattccatcgcagccgcgctggca
ccctatcccgcagacgcatgccgcgtcgaagagctggctggcgacgatatcttttgcctg
gctgagccgagcgggctgggggcgccgtacttccgtggcgatgtgggcgtcacattttca
gaagcggtcgctcacctgccgtcccggcacatcgcgctgctgttgcttgaaggcatcatc
tttcgcgtggcgcggatactggaagacttccaccgcgaattcggtatcgaaagcgcctat
ctttccggcggcctgtccggcctgcattgcctgcaacagggaatcgcgctgtgcgcgccg
tgcaccgtctaccggttggcgcaagccgatgccagcctgagcggggcagcacgcctggcg
gcgggcgctccttttgcgggccacaaggaggccgcaaggattgatattcccccggcgatg
ggccggctcgcggaaaaatttgcccgctggaaggtctggctggacgggttggtggccgca
agcccttccggacggggttga

DBGET integrated database retrieval system