KEGG   Sideroxydans lithotrophicus: Slit_2505Help
Entry
Slit_2505         CDS       T01196                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
slt01100  Metabolic pathways
slt01110  Biosynthesis of secondary metabolites
slt01130  Biosynthesis of antibiotics
slt01230  Biosynthesis of amino acids
Module
slt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Slit_2505
Enzymes [BR:slt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Slit_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ADE12730
UniProt: D5CN33
Position
complement(2536033..2536845)
Genome map
AA seq 270 aa AA seqDB search
MSDILNKILAVKNQEVAAALSAKPLPVIRAEAEQAAPARDFAGAIRNKIAAGLPAVIAEI
KKASPSKGVIRADFHPAEIAASYARHGAACLSVLTDEQFFQGSAAYLQQARAACDLPVLR
KDFMVHEYQVYQARAMGADAILLIASALTLNQMKTLEKLAHKLGMAVLVEVHDGKELEIA
LQLATPLIGINNRNLRTFEVSLQTTLDLLSHISASEEGQDRIVVTESGIFTAADVKLMRD
QQVHAFLVGEAFMRADEPGAELAKVFGMQP
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatccttaacaagattctcgccgtcaagaaccaggaagtcgccgccgcattg
tcggccaagccattgccggtgatccgtgccgaagccgagcaagccgcccctgcgcgggac
tttgccggcgccatccgcaacaagatcgcagccgggcttcccgccgtgatcgccgagatc
aagaaagccagccccagcaaaggggtcattcgtgcggatttccacccggccgagatcgcg
gccagttatgcgcggcatggggcggcctgcctgtcggtactgaccgacgagcagttcttc
cagggcagtgcggcgtacctgcagcaggcgcgcgccgcctgcgacctgccggtgctgcgc
aaggatttcatggtgcacgaatatcaggtctaccaggcgcgggcgatgggggcggatgcg
atcctgctgatcgcctccgccttgaccctcaaccagatgaagacgctggagaaactggcg
cacaaactgggcatggctgtgctggtggaagtgcacgatggcaaggaactggagatcgca
ttgcagctggccacgccgctgatcgggatcaacaaccgcaacctgcgcaccttcgaggtc
agcctgcagaccacgctcgacctgttgtcgcatatctctgcatccgaagaggggcaggat
cgcatcgtggtcacggaaagcggtatcttcactgcagcggatgtgaaattgatgcgcgac
cagcaggtgcatgccttcctggtcggcgaggcattcatgcgcgcggacgagccgggggcg
gagctggccaaagtctttggcatgcaaccgtaa

DBGET integrated database retrieval system