KEGG   Sideroxydans lithotrophicus: Slit_2724Help
Entry
Slit_2724         CDS       T01196                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:slt00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:slt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2756099..2757598)
Genome map
AA seq 499 aa AA seqDB search
MNAFNPDGLKLLGVNVRHLVSDSRSVNRDDTFVAYPGSQADGRHFIAQAIERGANSVIWE
EHGFKWNPTWSVPNLAVSDLRHQAGLIADLVYGQPSQKLWMVGITGTNGKTSISHWLAKS
FGALGRKSALIGTLGNGFPEALRATANTTPDALIVHGLLAEYEQQGARAAVMEVSSHALT
QGRVNGVHFDVALLTNLTRDHLDFHGDMQSYAAAKKRLFDWASLKYAVLNLDDMFGAELA
EQLQDASVEVIGYGLNDDSLKMAERLGIRMVYGSLTQMDAQGLTLQLHTSWGAAALCSRL
IGSFNASNLLGALAVLLASEVRIDDAARELGLQKAVAGRMQTLGGKGLPTVVVDYAHTPD
ALDKVLTTVREVTESAGGKVICVFGCGGDRDRGKRPMMGTVASKLADVRIITSDNPRSEE
AAEIVSEIAAGMQGEYQVIEDRAKAITLAIANARHIDTVLLAGKGHENYQEIKGVRYPFS
DSEIAHRALSMWSTEEQRQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccttcaacccggatggattgaaattgctgggagtgaatgtcaggcatctggta
tccgacagcaggtcggtcaatcgcgacgataccttcgttgcctatcccggatcgcaggct
gacgggcgtcatttcattgcacaagccatcgaacggggcgccaactcggtcatctgggaa
gagcacggcttcaaatggaatccgacctggagtgtgccgaacctggcagtgagtgacttg
cgccatcaggccggcctgatcgcagacctggtctatggccagccttcgcagaagctctgg
atggtcgggatcaccggcacgaatggcaagacatcgatcagtcactggctggcaaagtcc
ttcggcgcactgggccgcaagagtgcattgatcggcacattgggcaacggttttccggaa
gcgctgcgagcaacggcaaacacgacgccggatgcattgatcgtgcacggactgctggcg
gaatacgagcaacagggcgcccgggccgcagtgatggaagtgtcttcgcatgcactcacg
caaggcagggtcaatggcgtgcatttcgacgtggcgctgctcacgaatctgacgcgcgac
cacctcgattttcacggcgacatgcaaagctatgcggcggcaaagaaacgcctgttcgac
tgggcatcgctcaagtatgccgtgctcaacctggacgacatgttcggtgccgagttggcc
gagcaattgcaggacgcgtccgtcgaagtgatcggctatggtttgaacgacgattcgctg
aagatggcggagcgtcttggaatacgcatggtgtatggcagcctcacgcaaatggatgca
caaggtcttacgttgcagctgcataccagctggggtgcagctgcactgtgcagcagattg
atagggagcttcaatgcttccaatctgcttggcgcgcttgcggtattgctggcaagcgag
gtcaggatagacgatgcggcgcgcgagctcggattgcagaaagcagtggcgggacgcatg
cagacactgggtggcaaaggcctgccgacagtcgtcgtggattacgctcacacgccagat
gctctggacaaggtgttgaccacggtgcgcgaggtgacggagtccgcgggcggcaaggtc
atctgcgtgttcggatgcggcggcgatcgagatcgcggcaagcggccgatgatgggaacc
gttgcgtcaaaactggccgatgtgcggatcatcaccagcgacaatccgcgcagcgaggag
gcggcggaaatagtcagcgagatcgccgcaggcatgcagggcgaatatcaggtgatcgag
gatcgcgccaaagccatcaccctggccatcgccaatgcacggcatatcgataccgtgctg
cttgcaggcaaggggcatgagaattaccaggagatcaaaggggtacgctatcccttctcg
gacagcgagatcgcccatcgggcgctgagcatgtggagcaccgaggagcagcggcaatga

DBGET integrated database retrieval system