KEGG   Sideroxydans lithotrophicus: Slit_2931Help
Entry
Slit_2931         CDS       T01196                                 

Definition
(GenBank) dihydroorotase, multifunctional complex type
  KO
K01465  dihydroorotase [EC:3.5.2.3]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00240  Pyrimidine metabolism
slt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Slit_2931
Enzymes [BR:slt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     Slit_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_3 Amidohydro_1 DHOase DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ADE13156
UniProt: D5CQD5
Position
complement(2945884..2947158)
Genome map
AA seq 424 aa AA seqDB search
MNIHIKNGRLIDPHNKIDATQDVFIADKRIAAIGKAPQGFAAEQVIDAGGLIVMPGLVDV
AARLREPGYEYKATLESEMDAAMAGGVTSLSCPPDTDPPLDEPGLVEMLKHRARLLNQAR
VFPVGALTYGLKGAELTEMIELAEAGCKAFSQADALLTDTRVLMRAMQYAATFGYRVWLR
PQDAFLAKDGVAHDGEVATRLGLPAIPVVAETIALATMLQLARETGVKLHVCRISSAEGV
DMVRAAKRQGLAVTCDVSMNHVHLSEMDIGFFDANCRLMPPLRNLRDKAALRAGLLDGTI
DAICSNHSPVDEDAKQLPFAEAEAGATGMELLLPLVLKWAEQEKVPLLDALARVTINPAQ
LLGVKTGHLSVGAHADVCVFDPAITWKVEPAALKSQGKNTPFNGYTMQGKARHTIVEGKV
AYSL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatatcaagaacggtcgcctgatcgacccacacaacaagatcgatgccacg
caggatgtgttcatcgcggacaagcgcatcgctgcaatcggcaaagcaccgcagggattt
gccgccgagcaggtgatcgatgccggcgggctgatcgtcatgccgggactggtggatgtc
gcagcgcgcttgcgcgagccgggttacgagtacaaggccacgctggaatcggaaatggat
gcggcgatggcgggtggggtgacctccttgtcctgccctcccgataccgatccgccgctg
gatgagccggggctggtggagatgctgaaacaccgtgcgcgtttgctcaatcaggcacgg
gtgtttcccgtgggcgcgctgacatacggattgaagggtgccgaactgaccgagatgatc
gagctcgccgaggccggttgcaaagctttcagccaggccgatgcgctgcttaccgacacg
cgtgtgctgatgcgcgccatgcaatacgcggcgaccttcggctatcgagtgtggctgcgt
ccgcaagatgcattcctcgccaaggatggcgttgcgcatgacggcgaagtggcaacacgc
ctcggcctgcccgcgataccggtggtggcggaaaccatagcgcttgcaaccatgctgcag
ctggcaagggagactggcgtgaagctgcatgtttgccgtatctccagcgcggagggagtg
gatatggtgcgtgccgcaaaacgccagggactggcagtgacctgcgatgtatcgatgaac
cacgtgcacctgtccgagatggacatcggctttttcgatgccaactgccgcctgatgccg
ccattgcgcaacttgcgcgacaaagctgcgctgcgagccggcctgctggatggcaccatc
gatgcgatctgttccaaccactctccggtcgacgaagatgccaagcagctgccattcgcc
gaggccgaagcaggcgcaaccggcatggaattgctgctgccgctggtactgaaatgggcc
gagcaggaaaaagtgccgttgttggatgcactggcgcgggtgaccatcaaccctgcgcaa
ctgctaggcgtcaagaccggtcatctgagcgtgggcgcacatgccgacgtgtgcgtgttc
gatccggcgatcacctggaaagtcgagccagccgcactcaagagccagggcaagaatacg
ccgttcaacggctataccatgcaaggcaaggcaaggcacaccatcgttgagggcaaagtc
gcctattccttatag

DBGET integrated database retrieval system