KEGG   Sideroxydans lithotrophicus: Slit_2931Help
Entry
Slit_2931         CDS       T01196                                 

Definition
dihydroorotase, multifunctional complex type
Orthology
K01465  
dihydroorotase [EC:3.5.2.3]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Slit_2931
Enzymes [BR:slt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     Slit_2931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2945884..2947158)
Genome map
AA seq 424 aa AA seqDB search
MNIHIKNGRLIDPHNKIDATQDVFIADKRIAAIGKAPQGFAAEQVIDAGGLIVMPGLVDV
AARLREPGYEYKATLESEMDAAMAGGVTSLSCPPDTDPPLDEPGLVEMLKHRARLLNQAR
VFPVGALTYGLKGAELTEMIELAEAGCKAFSQADALLTDTRVLMRAMQYAATFGYRVWLR
PQDAFLAKDGVAHDGEVATRLGLPAIPVVAETIALATMLQLARETGVKLHVCRISSAEGV
DMVRAAKRQGLAVTCDVSMNHVHLSEMDIGFFDANCRLMPPLRNLRDKAALRAGLLDGTI
DAICSNHSPVDEDAKQLPFAEAEAGATGMELLLPLVLKWAEQEKVPLLDALARVTINPAQ
LLGVKTGHLSVGAHADVCVFDPAITWKVEPAALKSQGKNTPFNGYTMQGKARHTIVEGKV
AYSL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatatcaagaacggtcgcctgatcgacccacacaacaagatcgatgccacg
caggatgtgttcatcgcggacaagcgcatcgctgcaatcggcaaagcaccgcagggattt
gccgccgagcaggtgatcgatgccggcgggctgatcgtcatgccgggactggtggatgtc
gcagcgcgcttgcgcgagccgggttacgagtacaaggccacgctggaatcggaaatggat
gcggcgatggcgggtggggtgacctccttgtcctgccctcccgataccgatccgccgctg
gatgagccggggctggtggagatgctgaaacaccgtgcgcgtttgctcaatcaggcacgg
gtgtttcccgtgggcgcgctgacatacggattgaagggtgccgaactgaccgagatgatc
gagctcgccgaggccggttgcaaagctttcagccaggccgatgcgctgcttaccgacacg
cgtgtgctgatgcgcgccatgcaatacgcggcgaccttcggctatcgagtgtggctgcgt
ccgcaagatgcattcctcgccaaggatggcgttgcgcatgacggcgaagtggcaacacgc
ctcggcctgcccgcgataccggtggtggcggaaaccatagcgcttgcaaccatgctgcag
ctggcaagggagactggcgtgaagctgcatgtttgccgtatctccagcgcggagggagtg
gatatggtgcgtgccgcaaaacgccagggactggcagtgacctgcgatgtatcgatgaac
cacgtgcacctgtccgagatggacatcggctttttcgatgccaactgccgcctgatgccg
ccattgcgcaacttgcgcgacaaagctgcgctgcgagccggcctgctggatggcaccatc
gatgcgatctgttccaaccactctccggtcgacgaagatgccaagcagctgccattcgcc
gaggccgaagcaggcgcaaccggcatggaattgctgctgccgctggtactgaaatgggcc
gagcaggaaaaagtgccgttgttggatgcactggcgcgggtgaccatcaaccctgcgcaa
ctgctaggcgtcaagaccggtcatctgagcgtgggcgcacatgccgacgtgtgcgtgttc
gatccggcgatcacctggaaagtcgagccagccgcactcaagagccagggcaagaatacg
ccgttcaacggctataccatgcaaggcaaggcaaggcacaccatcgttgagggcaaagtc
gcctattccttatag

DBGET integrated database retrieval system