KEGG   Streptococcus lutetiensis: KE3_0083Help
Entry
KE3_0083          CDS       T02775                                 

Definition
multimodular transpeptidase-transglycosylase
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
slu  Streptococcus lutetiensis
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:slu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KE3_0083
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    KE3_0083
Enzymes [BR:slu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     KE3_0083
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     KE3_0083
Glycosyltransferases [BR:slu01003]
 Polysaccharide
  Bacterial polysaccharide
   KE3_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
78883..81192
Genome map
AA seq 769 aa AA seqDB search
MTKFKMIKEKLLSFFKSEKEEVPFKNHISQENDNDYLADDLSDFETENTEEQAAPTYQRS
KGYHEKAKKQPAWLQKLSRFMPSPKNPIRRFWRRYRVGKILLILVGIGVLAIGSYLFAVA
KSTNVSDLQDALKATTVIYDKNDNQVGSLSGQKGTYVELNAISDNMKNAVIATEDRSFYK
NGGINYSRFFLALFTMGRFGGGSTITQQLAKNAYLSQEQTVTRKAKEFFLAIELTKKYSK
DDILTMYLNNAYFGNSVWGVQDASRKYFGTDAANLTVEQSAILAGMLKGPEIYNPYYSVE
NATNRRNTVLGVMVDAGKITQAEANQAKQVDIASELNDTYTGNSDDYQYGSYFDAVIQEA
EKKYGLSENDIINNGYKIYTELDQNYQANMQAVFDNTAYFPVSDYDGQTAQGASVAMDPS
TGAVRGLVGRVSPSSATFRSFNYATQASRSPGSTIKPLVVYSPAVASGYAITTDLPNTPR
DYDGYSPTNYAGIETADLPMYQALANSYNIPAVYLLHKIGVSKGMSYGQKFGLNMKNVKE
ELGVALGGGVTTNPLEMAQAYATFANGGVMPKGHLITKIENASGQVIAEFKPSTKRVISQ
SVANKMTSMMLGTFSNGSAVNANAYGYTIAGKTGTVEANFNADLTSDQWVIGYTPDVVIA
QWIGYDSTDENHYLTDASSGTASIIFSAVASSILPYTAGTEFTVENAYSQNGYDLVYSAN
GQTATSQSSSSDNILDKVQESAQNAGDKIGRAVKDAWDNFSSWFNKQTN
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttaaaatgattaaagaaaagcttctttcttttttcaaatcagaaaaagaa
gaagtgcctttcaagaatcacatcagtcaggaaaatgacaatgattatctggctgacgac
ttaagtgactttgaaactgaaaatactgaagagcaggcagctccaacctaccaacgtagt
aaagggtaccacgaaaaagcaaagaagcagccagcttggctgcaaaagctttcgcgtttt
atgccatcacctaagaatcctattagacgtttttggcgtcgttaccgagttggaaaaatc
ttactcattttggttggtattggtgttttagccattggctcttatctttttgctgttgcc
aaatcaaccaatgtctcagatttgcaggacgcattgaaggcaacaactgttatttatgat
aaaaatgacaatcaagttggttcgctttcagggcaaaagggaacttacgttgagttaaat
gccattagcgataacatgaagaatgcggtaattgcaacagaagaccgttcattttacaaa
aatggcgggattaattactctcgtttcttcttagctttgttcaccatgggacgttttggt
ggtgggtcaaccatcacgcaacaattggctaaaaatgcttatctaagccaagaacaaacg
gtcactcgtaaagccaaagaattcttcttagcgattgaattgaccaaaaaatacagtaaa
gatgatatcttgaccatgtatttgaacaatgcttattttggaaattcggtttggggtgtc
caagatgccagccgcaagtatttcggaacggacgctgccaatctgactgttgaacaatca
gctatcttagcagggatgctaaagggtcctgaaatttataacccttactactccgtagaa
aatgcgacaaatcgccgcaatacggttttaggtgttatggttgatgcaggcaaaatcaca
caagcagaagccaatcaagctaagcaagttgatattgcaagtgaattgaatgatacttat
actggcaattctgatgattatcagtatggttcatactttgatgcggttattcaagaagct
gagaaaaaatatggcttgtctgaaaatgatatcatcaacaacggctataagatttacaca
gaattagaccaaaactatcaagcaaatatgcaggctgtttttgataacacagcttatttc
ccagtatctgattatgatggtcaaacagcccaaggagctagtgttgccatggatccgtca
actggtgcagttcgtggtttggttggacgtgtcagcccaagttcagcaactttccgtagc
tttaactacgcgacacaagcctcacgaagccctggttcaaccattaaacctctagtggtt
tactcaccagctgttgcttcaggttacgccattacgactgatttaccaaatacacctagg
gattacgatggttattctccaacgaactacgccggtattgaaacagcagaccttccaatg
tatcaagctttggcaaattcatacaatatcccagcggtttacttgcttcataaaatcggt
gttagcaagggaatgagctacggtcaaaaatttggtcttaacatgaaaaatgttaaggaa
gagttgggcgttgcccttggtggtggtgttacaaccaacccacttgaaatggctcaagct
tacgcaacctttgctaatggcggtgtgatgcctaaaggacatttgattacgaaaattgaa
aatgctagcggtcaagtgatcgcagaatttaaaccatcaaccaagcgcgtgattagccaa
tctgtagctaacaaaatgaccagcatgatgcttggaactttctcaaacggttctgcggtc
aacgccaatgcttatggttacacgatcgcaggtaagactggtactgtggaagctaacttc
aatgctgatttgaccagtgaccagtgggttatcggttatacgccagatgtggttattgca
cagtggattggttatgattcgacagatgaaaatcactacctgactgatgcaagttctggt
acagcgtctataatctttagcgcagtagcaagtagcattttgccatatactgcgggaaca
gaatttaccgttgaaaatgcttatagccaaaatggttacgatttggtttacagcgctaat
ggtcaaacagccacaagccaatcatcaagctctgataacatccttgataaggttcaagaa
tcagctcaaaatgccggagataagattggtcgggcggttaaagatgcttgggataacttc
tcaagttggttcaacaagcagactaactaa

DBGET integrated database retrieval system