KEGG   Streptococcus lutetiensis: KE3_0170Help
Entry
KE3_0170          CDS       T02775                                 

Definition
multifunctional alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
slu  Streptococcus lutetiensis
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:slu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KE3_0170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KE3_0170
   00620 Pyruvate metabolism
    KE3_0170
   00650 Butanoate metabolism
    KE3_0170
  Lipid metabolism
   00071 Fatty acid degradation
    KE3_0170
  Amino acid metabolism
   00350 Tyrosine metabolism
    KE3_0170
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KE3_0170
   00626 Naphthalene degradation
    KE3_0170
Enzymes [BR:slu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KE3_0170
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KE3_0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
171595..174276
Genome map
AA seq 893 aa AA seqDB search
MAKATNADVKNNELIAEELAQQYTGALVEKALEAERVYATYSQEQVDNIVAAMALAGSEA
SLELAKEAHTETGRGVVEDKDIKNHFATEYVYERIKNEKTVGIIGEDKVSGSIQIAAPLG
VLAGIVPTTNPTSTTMFKILVALKTRNAIVFAFHPQAQNCSAHAAQILYDAAIKAGAPEN
IVQWIETPSLANTSALIQNPKIASILATGGPGMVNAALKSGNPSMGVGAGNGAIYVDATA
HVDRAVEDLLLSKRFDNGMICATENSAVVEAPIYDEWLQKMQDKGAYLVPEKDYKKLEDF
VFNDRHGVNGPVAGMPARWICEQAGVKLPEGKDVLLFELDKKNIGEKLSSEKLSPLLSVY
KAKDRAEGVEIVEALLDYQGAGHNAGIQIGSQADPFVAEYGDAVKASRVLVNQPDSVGGI
GDIYTDALKASLTLGTGSWGKNSLSHNLSTGDLLNVKTVAKRRNRPQWIRLPEKTYYEKN
AISYLQDEYEPMQRALIVADPGMVQFGFVDTVLAQLALRDEKVATSIYGTIKPDPTLGQT
IEIAKQMRDFKPDTVIAVGGGSALDAAKIARYIYEYSLDQEADFLDSYENVSELFLRLQQ
KFIDIRKRIVKFKHQTATRLFCIPTTSGTGSEVTPYAVITDDHTHVKYPLTDYELTPQVA
IVDPEFVMTVPKRTVALSGLDTLSHALEAYVSVMASDLTRPWSLEAIKLVIENLEDSYNY
DPKHPTLRGEQARENMHYAATLAGMAFSNAFLGINHSIAHKTGGEFGLPHGLAISIAMQH
VIRYNGVAGNVKRSVFPRYEEYRAQRDYADIARSLDLKGKDDAALVEALCERIDALMKAV
DVDPRLSANGVTKEAFDAAVDKLASLAYDDQCTPANPRQPYISELKQLLIDMF
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaacaaatgcagatgtaaagaataacgagttgatcgcagaagaattggct
caacagtacactggagctcttgtcgaaaaagctcttgaagctgaacgtgtttatgcaact
tattcacaagaacaagttgataacattgtcgcagcgatggctcttgcaggttcagaagct
tcgcttgaattagcaaaagaagctcatacagaaactggtcgtggtgtcgttgaagataaa
gatattaagaaccacttcgctactgagtatgtttatgaacgtattaaaaatgaaaaaaca
gtaggtatcattggggaagataaggtttcaggaagtatccaaatcgcagcacctcttggt
gttttggctggtattgttccaacaacaaacccaacttcaacaacaatgttcaagattttg
gtggctcttaaaacacgtaatgcgattgtctttgccttccacccacaagcgcaaaactgt
tcagcacatgctgcacaaattctttatgatgcagcgattaaagccggtgctccagaaaac
attgttcaatggattgaaacaccatctcttgcaaatacatcagcgcttatccaaaatccg
aagattgcttctattttggcaactggtggacctggtatggtaaatgccgctcttaaatca
ggtaacccatcaatgggtgttggtgctggtaatggtgctatctacgttgatgcaacagca
cacgttgatcgcgctgttgaagacttgttgttatcaaaacgttttgataatggtatgatt
tgtgccactgaaaactctgcagttgttgaagcaccgatttatgacgaatggcttcaaaaa
atgcaagataaaggtgcctaccttgtgcctgagaaggactataaaaaactcgaagatttt
gtctttaatgacagacacggtgttaatggtccagttgctggtatgccagctcgctggatt
tgtgaacaagccggtgtgaaattgccagaaggaaaagatgttctcttgtttgaacttgat
aagaaaaatatcggtgaaaaactatcttctgaaaaactttctccactcctttcggtttac
aaagctaaagatcgtgctgaaggtgttgaaattgttgaagcacttcttgactatcaaggt
gcaggacacaatgctggtattcaaataggttctcaggcagacccatttgttgctgaatat
ggcgacgctgtgaaagcatcacgtgtcttggttaaccaaccagattcagtcggaggtatc
ggtgatatttacacagatgcacttaaagctagcttaacacttggaacaggatcatggggg
aaaaattcattgtcacacaatctttcaactggcgatctcttaaatgttaagacagttgcc
aaacgtcgcaaccgtcctcaatggattcgcctgccagaaaaaacatactatgaaaaaaat
gctatctcttacttgcaagatgaatacgaaccgatgcaacgtgctttgatcgttgctgac
ccaggaatggttcaatttggttttgttgatactgttcttgctcaattagcattgcgtgat
gaaaaagttgcaacatcaatttacggtactatcaaaccagacccaacacttggtcaaacg
attgaaattgccaaacaaatgcgtgatttcaaacctgatacagttattgcagtcggtggt
ggctctgcccttgatgcggctaagattgcacgttacatctacgaatactcacttgatcaa
gaagctgatttccttgatagctacgaaaatgtcagcgaactcttcttacgtttgcaacaa
aaattcatcgatatccgtaaacgtatcgtgaaattcaaacaccaaacagcaacacgtctc
ttctgtattccaacaacatctggtacaggttcagaagttacaccatacgctgttattact
gatgaccatactcacgttaagtatcctttgactgactatgaattgactccacaagttgcc
attgttgacccagaatttgttatgacagtgccaaaacgtacagtagctctttctggtctt
gatactttgtcacatgcccttgaagcttatgtttcagttatggcatctgatttgactcgc
ccatggtcacttgaagccattaagctggttattgaaaacttggaagattcatataactat
gatcctaaacacccaacacttcgtggtgaacaagcacgtgaaaacatgcactacgcagca
actcttgctggtatggccttctcaaatgctttcttgggtatcaaccactcaatcgcacac
aaaactggtggtgaatttggtcttccacatggtctagctatctcaatcgctatgcaacac
gttattcgttacaatggtgtggctggaaatgtaaaacgttcagtcttcccacgttatgaa
gaatatcgtgcacaacgtgactacgctgatattgctcgtagtcttgatcttaaaggtaaa
gatgatgcagcattggttgaagcactttgcgaacgtattgatgctttgatgaaagcagtt
gatgttgaccctcgtctttctgcaaatggtgttaccaaagaggcctttgacgcagctgtg
gataaattggcatcacttgcttacgatgatcaatgtacaccagcaaatccacgtcaacca
tacatttcagaattgaaacaattgttgattgatatgttctaa

DBGET integrated database retrieval system