KEGG   Streptococcus lutetiensis: KE3_0900Help
Entry
KE3_0900          CDS       T02775                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
slu  Streptococcus lutetiensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    KE3_0900
Enzymes [BR:slu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     KE3_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
858442..859032
Genome map
AA seq 196 aa AA seqDB search
MSLLAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVIIMTSALDTRDGYGIVSSRIGMRR
EAIAITNEMDVFAYVKALPEKPYCVLIDECQFLTKKHVYELARVVDELEVPVMAFGLKND
FQNELFEGSKYLLLLADKIDEIKTICQFCSKKATMVLRTENGKPVYEGDQIQIGGNETYI
PVCRKHYFNPMISTEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacttttggctcaactctattataaatatggaaccatgaattctggtaagaccatt
gaaattttaaaagttgctcataactatgaagaacaaggcaaacctgttatcatcatgact
tcagcacttgatactcgtgatggttatggtattgtttctagtcgtatcggtatgcgccgt
gaagctattgcaattactaatgagatggatgtttttgcttacgtcaaagctcttccagaa
aaaccttattgtgttcttattgatgaatgtcagtttttaacgaaaaagcatgtctacgaa
ttagctcgtgtggttgatgaactagaagtccctgtgatggcttttgggttaaaaaatgat
tttcagaatgaattattcgaaggttcaaaatacctactgcttttagcagataaaattgat
gaaattaaaactatttgccagttttgctcgaaaaaagccacaatggttttgcgaactgaa
aatggaaaaccggtttacgagggggaccaaattcaaattggtggaaatgaaacttacatc
cccgtttgtcgtaaacactattttaatcccatgatttcaactgaaaaataa

DBGET integrated database retrieval system