KEGG   Streptococcus lutetiensis: KE3_0908Help
Entry
KE3_0908          CDS       T02775                                 

Definition
cytoplasmic alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
slu  Streptococcus lutetiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:slu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(868114..869571)
Genome map
AA seq 485 aa AA seqDB search
MTNETLMQYFEWYLPNDGKHWKRLAADASHLAQKGITKIWMPPAFKATHDGDVGYGVYDL
FDLGEFNQKGTIRTKYGTKADYLEAISALKSNGIEPLADVILNHKAAADHTETFKVVEVA
PEDRTKVLSQPFEIEGWTNFTFDGRYHAYNDFEWHWYHFTGTDYDVRTGKTGIFQIQGDN
KGWANQDLVDGENGNYDYLMYSDLDFKHPEVLKNIYDWADWFVETTGVKGFRLDAIKHID
SFFMGNFIRDMKTKYGNDFYVFGEFWNGDEKSNKDYLTSTDYRFDLVDVRLHQNLFEASK
AKETYDLRQIFEQTLVKNHPDSAVTFVDNHDTQRGQALESTIEEWFKPAAYALILLRQTG
LPCIFYGDYYGISGQFAQKSFQDNIDKLLKLRKNAVYGQELDYFDQANCIGWTYLVDDER
PTALAVLINNSKATSKRMFVGEKWAGKLFTDALGNQTAHVQIDEQGYGDFLVGEKSISTW
IPLAK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaaactttgatgcaatactttgaatggtatttaccaaatgacggcaaacac
tggaaacgtttggcagctgatgcttctcatcttgcccaaaaaggtatcaccaaaatttgg
atgccccctgcttttaaagcgacgcatgatggtgatgtgggctatggcgtctatgacctt
tttgacctaggtgaatttaaccaaaaaggaaccattcgaacaaaatacggaacaaaagct
gactaccttgaagctatttcagctcttaaaagtaatggtattgagccattggctgatgtt
attttaaatcacaaagctgcagctgaccacactgaaacttttaaggttgtcgaggtagca
ccagaagatcggacaaaagtcctcagtcagccttttgaaattgaagggtggacaaatttt
acctttgatggtcgctaccatgcctataacgattttgaatggcattggtatcactttact
ggcacagactatgatgttagaactggcaaaactggcattttccaaattcaaggagacaat
aaaggctgggcaaaccaagatttggttgatggtgaaaatgggaactacgactatctcatg
tattccgacctagatttcaaacatccagaagtccttaaaaacatttacgattgggcagat
tggtttgttgaaacaactggggttaagggatttcgtttagacgccattaagcacatcgat
tctttcttcatgggaaactttattcgtgatatgaaaactaagtacggcaatgatttttac
gtttttggtgaattttggaacggtgatgaaaagtcaaataaagattacctcacaagtact
gattatcgatttgatttggtcgatgttcgtctgcaccaaaatctctttgaagcaagtaaa
gccaaggaaacttatgatttacgtcagatttttgagcaaaccttagtgaaaaatcatcca
gactctgctgttacttttgttgataatcatgatacccaacgtggtcaagcactggaatca
actattgaagaatggtttaaaccagcagcttacgccctcattttgcttcgtcaaaccggg
cttccttgcattttctacggagattattacggcatttcgggacaatttgcccagaaaagt
tttcaagataatattgataaattgcttaaacttagaaaaaacgccgtttatggtcaagaa
ctagattattttgaccaagctaactgtatcggttggacttaccttgttgatgacgaacgc
ccaactgctcttgctgttctcatcaacaatagcaaagccacatcaaagcgcatgtttgtt
ggagaaaaatgggctggtaaattgttcactgatgctcttggcaaccaaactgcgcatgtc
caaattgatgagcaaggctatggtgatttcctagttggtgaaaaatcaatcagtacttgg
ataccactagcaaaataa

DBGET integrated database retrieval system