KEGG   Streptococcus lutetiensis: KE3_1282Help
Entry
KE3_1282          CDS       T02775                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
slu  Streptococcus lutetiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KE3_1282
Enzymes [BR:slu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     KE3_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1249225..1250727)
Genome map
AA seq 500 aa AA seqDB search
MEKRASGVLMHITSLPGKQGVGTFGQEAYNFVDFLVETDQTYWQILPLTTTSYGDSPYQS
FSATAGNTHLIDLELLCKQGYLAKEDYETVNFGDDLENVDYARIFEARRPILEKAVAEFM
QSADNQKALAEFEKEATWVKDYAEFMAIKEFFGNKALQEWDDKAVVRREEAALETYREKL
KDVITYHKVTQYFFYQQWADLKAYANEKGIKIIGDMPIYVSADSVEVWTMPKLFKVDAEK
TPLCIAGVPADSFSDDGQLWGNPIYDWENHKKTNYAWWVYRIKEGIKLYDLLRIDHFKGF
SDYWEIRGDYKTANDGSWQPGPGRALFDVVRDELGELPIIAENLGYIDAKAEQLLTDTAF
PGMKILEFGFYDTEGKSIDAPHNCNKNSVAYNGTHDNEVVNGWYDNLTDEQKAFVDAYTH
RHEGEPITQTMLRTLFATVSDIAIATMQDILDKPAESRMNIPNTVGGNWQWRILKEDLTD
ERKAFLKDITALYCRKNTFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacgtgcaagtggtgtactgatgcatatcacatcattacccggcaaacaaggg
gtgggaacatttggtcaagaagcatataactttgttgatttcttggttgaaaccgaccaa
acatactggcaaatcctaccattaacaacgacaagttatggtgattccccttatcaatca
ttctcagcaactgctgggaatacacacttaattgacttagaattactttgtaaacaaggc
tatttagcaaaagaagactatgaaactgttaacttcggtgatgatttagaaaatgttgat
tatgctcgcatttttgaagctcgtcgtccaattttggagaaagcagttgcagaatttatg
caaagtgctgataaccaaaaagctttagctgaatttgaaaaagaagcgacatgggtgaaa
gattacgctgaattcatggccattaaagaattctttggcaataaagctttgcaagaatgg
gatgataaagcggttgttcgtcgcgaagaagctgctcttgaaacttatcgtgaaaaatta
aaagatgttattacttatcataaagtcactcaatatttcttctaccaacaatgggctgat
ttaaaagcttatgctaatgaaaaaggtattaagattatcggtgatatgccaatctacgtt
tctgctgatagcgtagaggtttggacaatgcctaaacttttcaaagttgatgctgaaaag
accccactttgtattgctggtgttcctgcggattcatttagtgatgatggtcaactttgg
ggaaatccaatttatgattgggaaaaccacaaaaaaacaaattacgcttggtgggtttat
cgtattaaagagggaattaagctctacgaccttcttcgtatcgaccactttaaaggcttc
tcagattattgggaaattcgtggggattacaagacagcgaatgatggtagttggcaacct
ggtccaggacgtgctttgtttgatgttgtacgtgacgaacttggcgaacttcctattatt
gcagaaaacctcggttatattgatgccaaagccgagcaattgttaactgacactgctttc
ccaggtatgaagattcttgaatttggtttctacgatacagaaggtaagagtatcgatgct
ccgcataactgcaataaaaatagcgttgcttacaacggcacacatgataacgaagtggtt
aatggttggtacgataacttgacagatgaacaaaaagcatttgttgatgcttatacacat
cgtcatgaaggcgagccaatcacacaaacaatgcttcgtaccttgtttgcaacggttagt
gatattgcaattgcgactatgcaagacattcttgacaaaccagctgagtctcgcatgaac
attccaaatactgttggtggcaactggcaatggcgtatattaaaagaagatttgacagat
gaacgcaaagctttcttgaaagacatcacagcactttattgccgcaaaaatacatttaaa
taa

DBGET integrated database retrieval system