KEGG   Solanum lycopersicum (tomato): 100301919Help
Entry
100301919         CDS       T02665                                 

Gene name
PLC5
Definition
(RefSeq) PI-phospholipase C PLC5
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00562  Inositol phosphate metabolism
sly01100  Metabolic pathways
sly04070  Phosphatidylinositol signaling system
sly04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100301919 (PLC5)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100301919 (PLC5)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100301919 (PLC5)
Enzymes [BR:sly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100301919 (PLC5)
Membrane trafficking [BR:sly04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100301919 (PLC5)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100301919 (PLC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y C2 EF-hand_like INT_SG_DDX_CT_C
Motif
Other DBs
NCBI-GeneID: 100301919
NCBI-ProteinID: NP_001234176
UniProt: K4C5V4
Position
6
AA seq 593 aa AA seqDB search
MGSSYNYYRMFGCFNRKFKIREREPPPDVRNAFFRYTGKANQMNADQLFRYLVEVQGEEE
CTIKDAEQIIQNVASRRHHLIRRLNHSLELDDFFFYLFQDDLNGAIKSQVHHDMTAPLQH
YFIYTGHNSYLTGNQLSSDCSEIPIVKALERGVRGIELDLWPNSGKDNIHVLHGRTLTTP
VPLLKCLKAIRDHAFFKSPYPVIITLEDHLTPDLQAKVAEMVIQIFGEMLYYPQSECLDE
FPSPEELKNRIILSTKPPKEYLESKNQRDTSPVGKDSFREDLLKKEKSEIGAEDHDTDER
SDSDQDDEDGDTSTSNDQQSSQPEAPKYKSLIAVHAGKAKHGLKRALREESNKVSRLSLS
EQEVVRAAEYYGTDLVRFTQKNILRVYPKGTRVTSSNFKPMTGWMHGAQMVAFNMQGYGK
SLWMMHGMFRSNGSCGYVKKPQFLMDKGPNNEVFDPKVKLPVKQTLQVRVYMGDGWRLDF
SHTHFDAYSPPDFYTKLYLVGVPADSRKKKTRILEDDWCPVWDEEFNFPLTVPELALLRI
EVREYDMSEKDDFGGQTCLPVSELRTGIRSVPLYDKKGHKMKSVRLLMRFQFL
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggggagtagttacaattattacagaatgtttgggtgtttcaaccgtaaatttaagatc
agggagagggagccaccgccggatgtgaggaatgcgtttttccggtacaccggtaaagct
aaccagatgaatgcggatcaactttttcggtatctggtggaggtacaaggagaagaagaa
tgcactattaaggatgcggagcaaattatacagaatgttgctagccggaggcaccatctc
atcagacgccttaaccattcacttgaactcgatgatttctttttttatctttttcaggat
gatctcaatggagcaatcaaatctcaggtgcaccatgacatgactgctccattgcaacat
tatttcatctatacaggtcacaattcctacctaactggaaatcaactcagcagcgattgt
agtgaaattcctatagttaaggctctagaaagaggtgtccgcggaatagaacttgattta
tggccaaactcagggaaagataatattcatgttcttcatggaaggaccctgactacacca
gttccacttcttaaatgcttaaaggccattagagaccacgctttttttaaatccccttat
cctgtcataatcacattggaagaccacctgacaccagatcttcaagctaaagttgcagag
atggttatccaaatctttggagaaatgttatattatcctcaatcggaatgcttagatgaa
tttccttcacctgaagagcttaagaatcgcattattctttctacaaaaccacccaaagag
taccttgagtcaaagaatcagagagatacatctccagtgggaaaagattcatttagagag
gaccttttgaagaaggagaaatcagaaattggtgccgaggatcatgacactgatgaaagg
agtgacagtgatcaagatgatgaagacggtgatacctccacctccaacgatcagcaatca
tcccaaccagaagcacctaagtacaagagtctgatagcagttcacgctgggaaggcaaaa
catggtttgaaacgtgcactaagagaggaaagtaataaagtcagtcgacttagtttgagt
gaacaagaagttgtaagagctgcagaatattatggaactgatttggttaggttcacacag
aaaaatattctaagggtgtaccccaagggaacaagagtgacctcctcaaatttcaagcct
atgactggctggatgcatggagctcagatggtagcattcaacatgcagggatatgggaag
tcactttggatgatgcacgggatgtttaggtctaatggaagctgtggctatgtgaaaaaa
cctcaatttctcatggataaaggcccaaacaatgaggtatttgatcctaaagtaaaattg
ccagtgaagcaaactttacaggttagagtatatatgggagatgggtggcgcttggatttc
agccacacacattttgatgcctattcaccaccagacttctacacaaagctatatttagtt
ggagttcctgcagatagtcgtaagaaaaagacaaggatactggaggatgactggtgtccc
gtatgggatgaagagtttaattttccattgacagtaccagagctggctttgcttcgaatt
gaagtacgagaatatgacatgtcggagaaggatgattttggtggacaaacatgtttgcct
gtctcagagttgagaacagggatccgatcagtccctctgtatgataagaagggtcataag
atgaaatctgttagacttctcatgcgatttcaatttctttga

DBGET integrated database retrieval system