KEGG   Solanum lycopersicum (tomato): 100301919Help
Entry
100301919         CDS       T02665                                 

Definition
PI-phospholipase C PLC5
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100301919
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    100301919
Enzymes [BR:sly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100301919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 584 aa AA seqDB search
MFGCFNRKFKIREREPPPDVRNAFFRYTGKANQMNADQLFRYLVEVQGEEECTIKDAEQI
IQNVASRRHHLIRRLNHSLELDDFFFYLFQDDLNGAIKSQVHHDMTAPLQHYFIYTGHNS
YLTGNQLSSDCSEIPIVKALERGVRGIELDLWPNSGKDNIHVLHGRTLTTPVPLLKCLKA
IRDHAFFKSPYPVIITLEDHLTPDLQAKVAEMVIQIFGEMLYYPQSECLDEFPSPEELKN
RIILSTKPPKEYLESKNQRDTSPVGKDSFREDLLKKEKSEIGAEDHDTDERSDSDQDDED
GDTSTSNDQQSSQPEAPKYKSLIAVHAGKAKHGLKRALREESNKVSRLSLSEQEVVRAAE
YYGTDLVRFTQKNILRVYPKGTRVTSSNFKPMTGWMHGAQMVAFNMQGYGKSLWMMHGMF
RSNGSCGYVKKPQFLMDKGPNNEVFDPKVKLPVKQTLQVRVYMGDGWRLDFSHTHFDAYS
PPDFYTKLYLVGVPADSRKKKTRILEDDWCPVWDEEFNFPLTVPELALLRTEVREYDMSE
KDDFGGQTCLPVSELRTGIRSVPLYDKKGHKMKSVRLLMRFQFL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggtgtttcaaccgtaaatttaagatcagggagagggagccaccgccggatgtg
aggaatgcgtttttccggtacaccggtaaagctaaccagatgaatgcggatcaacttttt
cggtatctggtggaggtacaaggagaagaagaatgcactattaaggatgcggagcaaatt
atacagaatgttgctagccggaggcaccatctcatcagacgccttaaccattcacttgaa
ctcgatgatttctttttttatctttttcaggatgatctcaatggagcaatcaaatctcag
gtgcaccatgacatgactgctccattgcaacattatttcatctatacaggtcacaattcc
tacctaactggaaatcaactcagcagcgattgtagtgaaattcctatagttaaggctcta
gaaagaggtgtccgcggaatagaacttgatttatggccaaactcagggaaagataatatt
catgttcttcatggcaggaccctgactacaccagttccacttcttaaatgcttaaaggcc
attagagaccacgctttttttaaatccccttatcctgtcataatcacattggaagaccac
ctgacaccagatcttcaagctaaagttgcagagatggttatccaaatctttggagaaatg
ttatattatcctcaatcggaatgcttagatgaatttccttcacctgaagagcttaagaat
cgcattattctttctacaaaaccacccaaagagtaccttgagtcaaagaatcagagagat
acatctccagtgggaaaagattcatttagagaggaccttttgaagaaggagaaatcagaa
attggtgccgaggatcatgacactgatgaaaggagtgacagtgatcaagatgatgaagac
ggtgatacctccacctccaacgatcagcaatcatcccaaccagaagcacctaagtacaag
agtctgatagcagttcacgctgggaaggcaaaacatggtttgaaacgtgcactaagagag
gaaagtaataaagtcagtcgacttagtttgagtgaacaagaagttgtaagagctgcagaa
tattatggaactgatttggttaggttcacacagaaaaatattctaagggtgtaccccaag
ggaacaagagtgacctcctcaaatttcaagcctatgactggctggatgcatggagctcag
atggtagcattcaacatgcagggatatgggaagtcactttggatgatgcacgggatgttt
aggtctaatggaagctgtggctatgtgaaaaaacctcaatttctcatggataaaggccca
aacaatgaggtatttgatcctaaagtaaaattgccagtgaagcaaactttacaggttaga
gtatatatgggagatgggtggcgcttggatttcagccacacacattttgatgcctattca
ccaccagacttctacacaaagctatatttagttggagttcctgcagatagtcgtaagaaa
aagacaaggatactggaggatgactggtgtcccgtatgggatgaagagtttaattttcca
ttgacagtaccagagctggctttgcttcgaactgaagtacgagaatatgacatgtcggag
aaggatgattttggtggacaaacatgtttgcctgtctcagagttgagaacagggatccga
tcagtccctctgtatgataagaagggtcataagatgaaatctgttagacttctcatgcga
tttcaatttctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system