KEGG   Solanum lycopersicum (tomato): 100736451Help
Entry
100736451         CDS       T02665                                 

Gene name
BAM1
Definition
beta-amylase (EC:3.2.1.2)
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100736451 (BAM1)
Enzymes [BR:sly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     100736451 (BAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 580 aa AA seqDB search
MAMSLPHQIGALSGTSLTAETGGVSCEVPAKGSSATSAMWRTPMTNLKVSVQKTGNEIDR
VSPSPSPPMSPMMGGGMRPDLSVACQALMEAQVEEVVEREYKVRNSSEKEKGVPVFVMMP
LDSVKTDHTVNRKKAMNASLQALKSAGVEGIMMDVWWGLVERDAPGEYNWGGYAELMEMA
KKHGLKVQAVMSFHQCGGNVGDSCTIPLPRWVVEEMEKDPDLAYTDQWGRRNFEYVSLGC
DTLPVLKGRTPVQCYSDFMRGFRDRFENLLGDTIVEIQVGMGPAGELRYPSYPEKDGIWK
FPGIGAFQCYDKYMISSLQGAAEAFGKPEWGHTGPTDAGQYNNWPEDTNFFKKEGGGWDS
QYGEFFLTWYSEMLLNHGERILQSAKAIFEDKGVKISVKIAGIHWHYGTRSHAPELTAGY
YNTRNRDGYLPIAQMLARHGAVFNFTCVEMRDHEQPQDAQCAPEKLVRQVALATQEAQVP
LAGENALPRYDDYAHEQILQASSLSINDQSGDREMSAFTYLRMNPDLFHPDNWRRFVAFV
KKMKEGKDANKCREQVEREAEHFVHITQPLVQEAAVALMH
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgagtctgccacaccagatcggtgccttatcaggaacatcgctcacggcggaa
accggtggagtttcatgcgaagttccggcgaaggggagttcagctacatcagctatgtgg
agaacaccgatgacgaatttaaaagtatcggtgcaaaaaacaggaaatgaaattgacagg
gtgtcgccgtcgccgtcgccgccgatgagtccgatgatgggaggaggaatgcgaccggat
ttatcggtagcgtgtcaagcgttgatggaggctcaggtagaggaggtagttgagagagaa
tataaggttaggaattcgtcggagaaagagaaaggtgttccggtgtttgttatgatgccg
ttggatagtgtgaaaacggatcatactgtgaatagaaaaaaggcgatgaatgcgagttta
caggcgttgaaaagcgccggtgtggaagggattatgatggatgtgtggtggggattggtg
gagagagatgcaccgggagagtataattggggcggttatgctgagcttatggaaatggcg
aaaaaacatggactcaaagttcaagctgtgatgtctttccatcaatgcggtggtaacgtc
ggcgattcctgcacgatccctcttccgaggtgggttgttgaggagatggagaaggatcca
gatcttgcatacacagatcagtggggaaggaggaattttgaatatgtatcgcttggttgc
gatacacttccagttcttaaaggaaggactcctgttcaatgctattctgatttcatgaga
gggtttagagatagatttgagaatctcttaggtgataccattgtggaaattcaagtcggg
atgggtccagccggagagctccgatatccatcctatcccgaaaaagatggaatatggaag
ttccctggaatcggtgcttttcagtgttatgacaagtacatgatcagtagcttacagggt
gcagcggaagcatttggtaagcctgaatggggacacaccggtccaaccgatgctggtcag
tacaacaattggccagaagataccaactttttcaagaaggaaggtggtggatgggatagt
caatatggggagttcttcctcacttggtattctgagatgcttttgaaccatggtgagagg
atactgcaatcagccaaggcgatattcgaggacaagggtgttaagatttcagttaagatt
gcaggtattcactggcactatggaacaaggtcccatgcccctgagctgaccgctggatac
tacaacacccgtaaccgagatggttaccttcccatcgcccaaatgcttgcccgccacggt
gcagttttcaacttcacatgtgttgaaatgcgtgaccacgagcagccacaagatgcacaa
tgtgcacctgagaagttggttaggcaggtggcgttagcaactcaggaagctcaagttcca
cttgctggggagaatgcattgccacgatacgatgattatgctcatgaacagatccttcaa
gcgtcctcgttgagcatcaacgatcaatcaggtgatagagagatgagcgcgtttacatac
ttgaggatgaatcctgacttattccatcctgataactggagacgattcgttgcctttgtg
aagaaaatgaaagaaggaaaagacgctaacaaatgccgcgaacaggtagagagggaagca
gagcatttcgttcatataactcagccgttagtacaagaagctgcagtagccctaatgcac
taa

DBGET integrated database retrieval system