KEGG   Solanum lycopersicum (tomato): 100736474Help
Entry
100736474         CDS       T02665                                 

Gene name
MAPK6
Definition
(RefSeq) mitogen-activated protein kinase 6
Organism
sly  Solanum lycopersicum (tomato)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 376 aa AA seqDB search
MSLDSSSADHGGHSNIRGVPTHGGRYVQYNVHGSLFEVSRKYVPPIRPIGRGANGMVCAA
VNSETREEVAIKKIGNAFDNVIDAKRTLREIKLLSHMDHENVIAIKDVIRPPQKKNFNDV
YIVYELMDTDLHQIIHSNQQLTDEHCRHFLYQILRGLKYIHSANILHRDLKPSNLLVNAK
CDLKIGDFGLARTTTETDFMMEYCVTRWYRAPELLLNCSEYTSAIDIWSVGCILGEILTR
QPLFPGRDYVHQLRLITELIGSPDDASLGFLRSNNARRYVRQLPRYPRQQFAARFPNSSP
RAVDLLEKMLIFDPSRRITADEALCHPYLAPLHEINEEPVCPRPFSLDFEQPSLTEDNIK
ELIWREAAKFNPDPTH
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgattcaagttcagctgatcatggtgggcacagtaacataagaggggttcca
actcatgggggtcgttatgttcagtataatgtgcacggctctctgtttgaagtttcaaga
aaatatgttcctcctatcagacctattggtcgtggagctaatggaatggtttgtgctgct
gtgaactcggagacacgtgaggaagtagctattaagaagattgggaatgcatttgataat
gtaatagatgccaagaggacattaagagagataaagcttctcagtcacatggatcatgag
aatgtgattgcaattaaagatgttatacggcctcctcaaaagaaaaattttaatgatgtg
tacattgtttatgaactgatggacactgatcttcatcagattattcattccaaccaacag
ctgactgatgaacactgtcgacattttctgtaccaaatactgcgaggacttaagtacatt
cactctgccaatatcttgcatcgtgatttaaaacccagcaatttgcttgtcaatgcaaaa
tgtgacctaaagattggagattttgggctagcaaggacgacaactgagacagatttcatg
atggaatattgtgtgacacgctggtaccgtgcaccagagttgctactaaattgttcagaa
tatacatcggcaattgatatttggtcagtgggttgcatactcggtgaaatattgacaaga
caacccctttttcctggaagagattacgtacaccagttgagacttatcactgagctaata
ggctcaccagatgatgccagccttgggtttctccggagtaataatgcccggagatacgtt
agacaacttccaaggtacccaaggcaacaatttgctgccagattcccaaattcatctccc
cgagctgtagatttgcttgaaaagatgctcatctttgatccaagcaggcgtattacagct
gatgaagctctctgtcacccatacttagcacctcttcatgaaatcaacgaagaacctgtt
tgtccgaggcctttcagtttggattttgagcagccatctctcactgaagataatatcaag
gagctcatctggagggaagctgcaaaatttaatcctgatccaactcattga

DBGET integrated database retrieval system