KEGG   Solanum lycopersicum (tomato): 100736512Help
Entry
100736512         CDS       T02665                                 

Gene name
MPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K20535  mitogen-activated protein kinase 1/2 [EC:2.7.11.24]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:sly00001]
 Environmental Information Processing
  Signal transduction
   04016 MAPK signaling pathway - plant
    100736512 (MPK9)
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100736512 (MPK9)
Protein kinases [BR:sly01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100736512 (MPK9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH FTA2 Abi_C
Motif
Other DBs
NCBI-GeneID: 100736512
NCBI-ProteinID: NP_001233761
UniProt: D9J1Y9
Position
4
AA seq 372 aa AA seqDB search
MATPVEPPNGIRSPGKHYYSMWQSLFEIDTKYVPIKPIGRGAYGIVCSSVNRESNEKVAI
KKINNAFENRVDALRTLRELKLLRHLRHENVIALKDVMMPIHRRSFKDVYLVYELMDTDL
HQIVKSSQTLTNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLA
RTSSGKDQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPVFPGTECL
NQLKLIINILGSQREEDLEFIDNPKARKYIKSLPYSPGTPFSRLYPQAHPLAIDLLQRML
VFDPSKRISVMEALQHPYMSPLYDPNTDPPAQVPINLDIDEDLGEETIRDMMWTEILHYH
PEAATAAMEEVM
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcaactccagttgagccaccaaatgggataaggtccccagggaaacattactattct
atgtggcaatccctttttgaaattgatactaaatatgtacctattaagcctattgggcga
ggggcatatggaattgtttgttcttctgttaacagggaatccaatgagaaggttgcaatc
aagaaaataaacaatgcttttgagaatcgtgttgatgctctcaggacattgcgtgaacta
aagctccttcgccatctaagacatgaaaatgtgattgctctgaaagatgttatgatgcca
atccataggcgaagtttcaaagatgtttatctggtatatgaactaatggatacagattta
catcaaatagtcaaatcctctcaaacactcacgaatgatcattgccagtatttcctattc
cagttgcttcgaggtctaaagtatctccattcggcgaatattcttcatcgtgacttgaag
cccgggaacctgctcatcaacgctaactgtgatctgaaaatatgtgatttcgggcttgca
cgtacaagcagtggcaaggaccagtttatgactgagtatgttgttacacgctggtacagg
gcgccggaacttctcctttgctgtgacaactacggaacatccattgatgtatggtctgtt
ggttgcatttttgcggagctcttagggaggaaacctgtctttccaggtacggaatgcctg
aaccaactgaaattgattatcaacatccttggtagccaaagggaagaagatttagaattt
atcgacaatccaaaggcaaggaagtacatcaaatcacttccatattctcctggaacacca
ttttcccgcctctatccccaagctcatccattggcgattgatctcctgcagaggatgctt
gtgtttgacccttccaaaagaattagtgttatggaagcacttcaacacccatacatgtct
cctttgtatgatccgaacactgatcccccagcgcaggttcctatcaaccttgacatagac
gaggacttgggagaagagacgataagggacatgatgtggacggaaatacttcattaccat
cctgaagctgccacagctgctatggaagaagttatgtga

DBGET integrated database retrieval system