KEGG   Solanum lycopersicum (tomato): 100736513Help
Entry
100736513         CDS       T02665                                 

Gene name
MAPK4
Definition
mitogen-activated protein kinase 4 (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sly  Solanum lycopersicum (tomato)
Brite
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100736513 (MAPK4)
Protein kinases [BR:sly01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100736513 (MAPK4)
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100736513 (MAPK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 372 aa AA seqDB search
MDAENIENSVEIKGIPTRDGKYVEYNVVGNLFEVTSKYVPPIQPVGRGAYGIVCCATNSE
TKEEIAIKKIGNAFENRIDAKRTLREIKLLSHMDHENVIKIKDIVRPPDREEFNDVYIVY
ELMDTDLHQIIRSSQALTEDHCQYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLK
ICDFGLARTTSEADFMTEYVVTRWYRAPELLLNCTEYTAAIDIWSVGCILMELIKREPLF
PGRDYAQQLGLIIKLLGSPEESDLGFLRSDNARKYVKQLPQVPKQPFSEHFPDVSPLALD
LAEKMLVFDPAKRITVEDALNHPFMISLHEINEEPVCTSPFNFDFEQASLSEEDIKELIW
NEALKFDPDTTK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgaaaacattgaaaattcagtggaaatcaaaggaattcctactcgggatggt
aaatatgttgagtacaatgttgtgggtaacttatttgaagttacctcaaagtatgtccct
ccaattcaacctgtaggccgtggagcttacggaatcgtctgctgtgctacaaattcggag
acgaaggaggagatagcaataaaaaaaattgggaatgcatttgaaaatagaattgatgca
aagaggacccttcgcgagatcaaacttctttctcacatggatcatgaaaatgtcatcaaa
ataaaagatatagtaagaccaccagacagagaggaattcaatgatgtgtatattgtgtat
gagctaatggatactgatctgcatcagataatacgctcttcacaggccctcacagaagat
cattgtcaatactttctctatcaattattacgtggactcaagtatgtacattctgctaat
gttcttcaccgggatctgaaacctagcaacttgctactcaatgcaaactgtgacctcaag
atctgtgattttgggcttgctagaactacttcagaggcagattttatgactgagtatgtt
gttacccgatggtatagggcacccgagctactacttaattgtactgaatatactgcagcg
attgatatatggtcagttggttgcattttgatggaactcattaagagagagcctcttttt
cctggcagagactatgctcagcaattggggcttatcattaagttattaggttcaccggag
gagtctgatcttggattcctaaggagtgacaatgctaggaagtacgtcaagcagctgcct
caagttccaaagcaaccattttccgagcatttccctgatgtgtcccctttagcccttgat
cttgcagaaaagatgttggtttttgatccagctaaacgcataactgttgaggatgcattg
aaccatccattcatgataagtctccatgagataaacgaggaaccagtttgcacttctcct
ttcaacttcgactttgaacaagcatctctaagcgaggaagacattaaggagctcatatgg
aacgaggctcttaagtttgatcccgatacaaccaagtga

DBGET integrated database retrieval system